KEGG   Acyrthosiphon pisum (pea aphid): 100164943Help
Entry
100164943         CDS       T01076                                 

Definition
NAD-dependent protein deacetylase Sirt6
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100164943
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 351 aa AA seqDB search
MSCNYADGLSPYEYKGEVGMNEVFDTPEVLKQKISLLAEWIKDSKYTVFHTGAGISTSAG
IPDFRGPKGVWTLEKEGKKPEVNLDFNDAKPTVTHMAIKSLVKKGYAKYVVSQNIDGLHL
KSGLLRQHVSEVHGNMFTMRCNKCRRSYVSKTAVKTVGQRCLDIKCFGKNKNGNQCRGIL
YDTILDWEHQLPTEELELSELHSKMADLCICLGTSLQIQPINLVPFNAKKNKGKVVICNL
QKTNCDRKADLVIHTYVDNLMKSLMDILGVEIDEYDDMKDPTNINSETTDWTIYEIDLKK
VREIKRNTTKSKKRKKSEAKFSNTESETELPCNNQILKPSKISKLNNIDNI
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgcaactatgctgatggtttatctccatatgaatataaaggggaagttggtatg
aatgaagtttttgatactcctgaagttttgaaacaaaagatttcgcttcttgctgagtgg
atcaaagattcaaaatacacagtttttcacacaggtgctggtataagtacatcagcggga
ataccagatttccgaggaccaaaaggagtatggactttagaaaaagaaggaaagaaacca
gaagttaatttagatttcaatgatgctaaaccaacagttacacatatggcaatcaaaagc
ttggttaaaaaaggttatgcaaaatatgttgtcagtcagaatatagatggtttgcatttg
aagtcaggattactacgtcaacatgtttctgaagttcatggaaatatgtttaccatgaga
tgtaacaaatgcagaaggagctatgtgagcaaaactgctgtaaaaacagttggacagcga
tgcttggatataaaatgtttcgggaaaaataagaatggtaatcaatgccgaggtatttta
tatgatacaatattagactgggaacatcaattacccactgaagaactggagttatcggag
ttacattctaaaatggctgatttatgcatttgtcttggaacttcattacaaattcaacca
atcaatctggtcccatttaacgcgaagaaaaacaaaggaaaagttgttatttgcaattta
caaaaaaccaactgtgatcgtaaagcagatttagttattcatacatatgtagacaatttg
atgaagtctctaatggatatccttggagtagaaattgacgaatacgacgatatgaaagat
ccaacaaacataaattctgaaaccactgattggacaatttatgaaatagatttaaaaaaa
gtacgagaaatcaaaagaaacactacaaaatcaaaaaaacgaaaaaagtctgaagccaaa
ttttctaatacggaatcagaaacagaattgccttgtaataatcaaattcttaagccatca
aaaatctctaaactcaataatattgataatatt

DBGET integrated database retrieval system