KEGG   Acyrthosiphon pisum (pea aphid): 100165118Help
Entry
100165118         CDS       T01076                                 

Definition
dentin sialophosphoprotein
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:api00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100165118
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 556 aa AA seqDB search
MMLDQENQPNLPNGTESSNSSFQDKTVIKNGVSDNIFSSHEEYLGDVSLGGFNVSQLTNK
LERLALATPQVSKIRPDSIVIEDDFDLKERPDSADSDSGRPVTSNDSSIYRSFVTDSVEN
QQLDSLDFSSTICNEDINDSGSNIESIHENLTSVNLDLVGSDFEDSSHNVTLHSFSNKST
EEISHQLNPDFNNSAQKLNISLMDGIGSEKIFQSNIFESEIKNSSEAGPVIAEGFNSSAG
YNFDNLEALESVRSLNEEDIRRLTISRKSLYVAFDPIVKKSNEESNARKEAFENILVTDK
TVLTSSPQSSGSNKSLNISDTKMNQSITKDEKISNSSNSKTNDREKCYQDKIEKLECEIK
NLKNECIADKEKIKNLTNSLISVTKSKDQLSTVIGEYEKTISDMVSKKEDVHKEYEARIA
YIEEERAKMERHLQNSELAFNDVHEKYNSSKQVIEAMKENETKYKNCIKEFEESLKKYED
KYMRLKIHATEQMNKATEEINDKERSFEAETSKMRIMNKRLEVKVRSLQESLDRKDVENA
ELTNLCDELIGKLDRN
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgatgctcgaccaagaaaatcagcctaatcttccaaatggaacagaatcatcaaacagt
tcatttcaagacaagacagtcataaaaaatggtgtttcagacaatattttcagtagtcat
gaggaatatttaggtgatgtgtcattgggtggttttaacgtttctcagctcacaaacaaa
ttagaacgtctagctttagctactccacaagtgtcaaaaatcagacctgatagtatagtg
attgaagacgattttgatctaaaagaacgcccagattcagctgattcagatagcggtagg
cctgtaacttcaaatgacagttctatttacaggtcatttgttacagattctgttgaaaac
caacagttagatagtttagacttttcttcaactatatgcaacgaagacattaatgactct
ggcagtaatatcgaatcaatacatgaaaatttaacatcagtgaatttggatttagttggc
tctgattttgaagactcttcgcataatgtaactctacattctttctcaaacaaatcaaca
gaagaaatatcacatcaattaaatccagacttcaacaattcagcacagaaactaaatatt
tcgctaatggatggtataggatcagaaaaaatattccagtcgaatatttttgaaagtgaa
atcaaaaattctagtgaagcaggacctgtaatagctgaaggtttcaattcatctgcgggg
tataattttgataatctagaagctcttgaatccgtgagatcgttaaatgaagaagatatt
agaaggttaactatttccagaaaatctttatatgtagcatttgaccctattgtgaaaaaa
tctaacgaggagtccaatgctcggaaagaagcatttgaaaatatactagtcacagataaa
acagtattgactagttctccacaatctagtggttctaacaaatctctgaatatttcagat
accaaaatgaatcagtctattaccaaagacgagaaaatcagtaacagttctaattccaaa
actaatgacagagaaaaatgttaccaagataaaatagaaaagttggaatgcgaaatcaag
aaccttaaaaacgaatgtattgcggacaaagaaaaaattaaaaatttgaccaactcattg
atatcagtaactaaaagtaaagatcaattgagtactgtgattggagaatatgaaaaaact
atttctgatatggtctctaaaaaagaagatgtacataaagaatatgaagctcgaattgcg
tatattgaagaagaaagagcaaaaatggaacgtcacctacaaaattcagaattggcattc
aatgatgttcacgaaaaatataattcctcaaagcaagtaatagaggcaatgaaagaaaac
gaaacaaaatataaaaactgtattaaagaatttgaagaatctctcaaaaagtatgaagac
aaatatatgaggttaaaaatacatgccaccgaacaaatgaataaagccactgaagaaata
aatgataaggagagatcatttgaggcagaaacttcaaaaatgagaataatgaacaaacgc
ttagaggtgaaagtcagatcattacaagagtcgttagataggaaagacgtggaaaacgct
gagctaactaatctttgcgacgaactaatagggaaattagatagaaactga

DBGET integrated database retrieval system