KEGG   Acyrthosiphon pisum (pea aphid): 100165125Help
Entry
100165125         CDS       T01076                                 

Definition
calcium-binding protein p22-like
Orthology
K17610  
calcineurin B homologous protein 1
Organism
api  Acyrthosiphon pisum (pea aphid)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 191 aa AA seqDB search
MGNRSSLLLRKEEIAQIRNETGFTANQIERLYSRFTSLDRGDLGTLSREDLLRIPELAIN
PLGERIVDLFHADFGNNCDRINFLQFMRGLSKFRPIRPNKPNKQNNRMEKVKFAFDMYDV
DNDGMISKDELLVILHMMVGANISEEQLSIIADKTISEADVDEDGLISFDEFSKTFEKSD
IEHKMSIRFLN
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaccgatcatcgttgcttttgcgaaaagaagaaattgctcaaattagaaatgaa
actggattcactgcaaatcaaatagaacgtctttacagtaggtttaccagtttggataga
ggcgatttgggtacgctcagtagggaagatttactgcgtattccagagttggcaataaat
cctttaggtgaaagaatcgttgatttattccacgcagactttgggaataattgtgatcgt
attaatttcttacaattcatgagagggctgtctaaatttagaccaattcgaccgaataaa
ccaaacaaacaaaacaatagaatggagaaagtaaaatttgcttttgatatgtatgatgtt
gataatgatggaatgatatcaaaggatgaacttttggttattttacatatgatggttggt
gccaacataagtgaagaacagttgtctataatagcggataagacaatttctgaggcagac
gtagatgaagatggtttaatttcatttgatgaatttagtaaaacatttgaaaagtctgat
attgaacataaaatgtcaattagatttttaaactaa

DBGET integrated database retrieval system