KEGG   Acyrthosiphon pisum (pea aphid): 100165375Help
Entry
100165375         CDS       T01076                                 

Definition
ubiquitin C-terminal hydrolase UCHL1-like
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
api  Acyrthosiphon pisum (pea aphid)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 233 aa AA seqDB search
MSTSWIPLESNPAVMNKFLQKLGVPSEWEICDIFGFGPDELAIVPRPVASVILLFPYNDA
YEKRKNEEELKLKDKGQQVSDDIYFVKQYVHNACGTMALIHSVANNRDKIKLNDGILKRF
LDDGKNMSPSDRGEMLTKAEDMINTHKEIATEGQTAAPNPDDVPPYHFIAFVCKDGCLYE
LDGGKFDPINHGPTKPDSLLEDTVNLIQEKFVVQDPDSIYFTLLALSNVCDAY
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgtcatggatacctttagaatccaacccagcggtgatgaacaagtttttgcaa
aagttgggagtaccaagtgaatgggaaatatgtgatatttttggatttgggcccgatgaa
cttgccattgttcctagaccagttgcttccgtaattctgttatttccatacaatgatgct
tatgaaaagcgtaagaatgaagaagagttgaaattaaaagataaaggtcaacaagtatca
gatgatatatattttgtcaaacaatatgtacacaatgcttgtggaaccatggctttaatt
catagtgttgctaataatagagataagataaaactaaatgatggtatattaaaacgtttt
ttggacgatggaaaaaatatgtctccaagtgaccgtggtgagatgttgaccaaagccgaa
gatatgattaatactcataaggaaattgctactgaaggacaaactgcggcacccaatcca
gatgatgtaccaccttatcactttattgcttttgtttgcaaggatggatgtttatatgaa
ttagacggtggaaagtttgatcctattaatcatggacctacaaagccagattcattgctt
gaagatacagttaacttaatccaagaaaaatttgttgttcaagatcctgatagcatttac
tttactttactggcattgtcaaacgtatgtgatgcttactaa

DBGET integrated database retrieval system