KEGG   Acyrthosiphon pisum (pea aphid): 100165509Help
Entry
100165509         CDS       T01076                                 

Definition
(RefSeq) membrane-bound alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00730  Thiamine metabolism
api00790  Folate biosynthesis
api01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    100165509
   00790 Folate biosynthesis
    100165509
Enzymes [BR:api01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100165509
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100165509
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:api00537]
 Enzymes
  100165509
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase
Motif
Other DBs
NCBI-GeneID: 100165509
NCBI-ProteinID: XP_001944129
APHIDBASE: ACYPI006455
UniProt: J9K135
Position
Un
AA seq 513 aa AA seqDB search
MISSYFTLLIILLIIFVYTEKTVARTKPYPKPKSSIDDYFADKGRPLQQTREYDAQFWMN
RGMSDLGRRLKELENPIVGRAKNIVFFLGDGMSIATVTAARVHMEQSSGSAFPDGNASLT
FENFPYTGLVRTYCVDKQVADSACSSTAYMTGVKANSGTVGVSGAVRENDCKASLNPKNQ
VDSILRWAQMAGKSTGIVTTTRVTHASPAGGYAHSANRGWESSAPDDCLDIAQQLVTQSP
GIELDVILGGGRQEFLPKNMNGNREDGRDLIAEWKVRMMKNHQIYEYVKNKTELSDVNLK
DVDKLLGLFSMSHMSYTGTKEVERDEPSLSEMTMAAIEVLRKNENGYVLFVEGGRIDHAH
HQNLAHMALSETIAFSRAVDVADTVTDPEDTLIVVTSDHSHTMTINGYPSRGDKIIERVD
RGGESYSILSYANGPSAKFHKYQKQPSKYGDKFDLYPSLVPMSLETHGGEDVAVWTRGPW
AHLFVGSFEQNVLPLIMSYASCIGPSKGKCSDR
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgatttcctcttactttacgttgctaataattttacttattatttttgtttacaccgaa
aaaacggttgctcggacgaaaccgtatccaaagcccaagtcatcgatcgatgattatttc
gcggacaagggacgacctctacagcagacacgagaatacgatgcacaattttggatgaac
cggggcatgtctgacctggggcgtcggctcaaagagctagagaatccgatcgtcggtcgg
gccaaaaacatagtgttcttcttaggcgacggcatgtccattgcaactgtgaccgcagcc
agagtgcacatggaacagtcatccggcagtgcgttcccggacggtaatgcatcgctgacg
tttgaaaacttcccgtacaccggattggtcaggacgtattgtgtcgacaagcaagtggcc
gattcggcttgctcgtcaaccgcttacatgaccggcgtcaaggcgaattcaggcacggta
ggcgtttcgggcgccgtccgggaaaacgactgcaaagcgtcgttaaaccccaagaaccaa
gttgactcgatattgcggtgggcccagatggctggaaagtctactggaatcgtcactacc
acgagagtaacgcacgcgtcgccagctggcggttacgctcactcggctaacagaggttgg
gaaagtagtgcacccgatgattgtttggacatagctcaacaactggtgactcaatctccc
ggaattgagttggatgtaatccttgggggtggtcgtcaagagttcctgccgaaaaatatg
aacggcaatcgagaagacggccgagacctaatcgccgagtggaaggtgcgcatgatgaag
aaccaccaaatatacgaatatgtgaaaaacaaaacggaactgtcggatgtgaatttaaaa
gacgtggacaaactgttaggtctgttctccatgagtcatatgtcttacaccggcaccaag
gaagtggagagagacgagccatcacttagcgaaatgactatggcagctatcgaggtgttg
cggaagaacgaaaacggatatgtactattcgtcgagggtggcagaatagatcatgcgcat
catcaaaatttggcacacatggcgttaagcgaaactattgctttttctcgagctgtggac
gtagccgacaccgtcacagatcctgaagacacgttgatcgtggttacgtcagaccattcg
cacacgatgaccataaacggatatccatccagaggtgacaagatcatcgagcgtgtggac
cgcggtggcgaaagttactcaattttaagttatgctaacgggccgtccgccaagttccac
aagtaccagaaacagccatccaagtacggtgataaattcgatctttacccgtcgttggtg
cccatgtccctggaaacacacggcggtgaagacgtggctgtatggactcgaggcccgtgg
gcccatctgttcgtcgggagcttcgaacagaacgtactgcctctgatcatgtcatatgcg
tcatgcataggtcccagcaaaggaaagtgctcagatagataa

DBGET integrated database retrieval system