KEGG   Acyrthosiphon pisum (pea aphid): 100165517Help
Entry
100165517         CDS       T01076                                 

Definition
histone H2B.3-like
Orthology
K11252  
histone H2B
Organism
api  Acyrthosiphon pisum (pea aphid)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 126 aa AA seqDB search
MAPGGKSAGGKAMKKSGKAQKNIAKSDKKRKPKRKESYAIYIYKVLKQVHPDTGVSSKAM
SIMNSFVNDLFERIASESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggctccaggaggtaaatccgcaggcggcaaagcgatgaagaagtccggtaaggctcaa
aagaacatcgccaaatccgacaagaaacgcaagcccaagaggaaagaatcgtacgctatc
tacatctacaaagtgctgaagcaagtgcacccagacactggcgtttcctcaaaggcaatg
agcatcatgaacagtttcgtcaacgatctcttcgaacgtatcgcttctgaatccagtcgt
ttggctcactacaacaagcgttcaactatcaccagtcgggaaatccaaaccgccgtccgc
ctcttgttgcccggcgaattggccaagcacgccgtcagtgagggaaccaaagccgtcacc
aaatacacgagctccaaataa

DBGET integrated database retrieval system