KEGG   Acyrthosiphon pisum (pea aphid): 100165657Help
Entry
100165657         CDS       T01076                                 

Definition
trifunctional enzyme subunit alpha, mitochondrial
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100165657
   01212 Fatty acid metabolism
    100165657
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100165657
   00650 Butanoate metabolism
    100165657
  Lipid metabolism
   00062 Fatty acid elongation
    100165657
   00071 Fatty acid degradation
    100165657
   01040 Biosynthesis of unsaturated fatty acids
    100165657
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100165657
   00310 Lysine degradation
    100165657
   00380 Tryptophan metabolism
    100165657
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100165657
Enzymes [BR:api01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     100165657
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100165657
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 760 aa AA seqDB search
MALYRLVGISNEMSLINVKRALTTGRRLLSQDIKHTSSKVIDDILVITLNTPNSKVNSLS
HDVMDELQTNLNKASQDPSIKGSVIISGKPNCFIAGADISMLQACRTAEEVHKISHDGQN
ILNQVEKSTKPVVAAIMGSCLGGGLEVAMACHYRIAVKSKNTALGLPEVMLGLLPGGGGT
QRLPKLVAMPTVLDMALTGKSYRADKALKVGLIDQLVTPLGPGLSTPTERTLEYLEEIAI
DAAKKLAAGHKLTKRNKNKTLIDKVIDLALQQEWLREKFFDSAKGKVLKMTGGLYPAPLK
IIDVIKTGIAHGTTKGYAAESNGFAELAMTPQSKGLIGLFQGQTECKKNKFGEPKVALKT
VGVLGAGLMGAGIAHVTVDKGLQVILKDTNKEGLAKGIAQIEKGLTGAVKRKKLTAIEKD
RYVSDLTSTLSYESFSKADIVIEAVFENIKIKHQVIKELEQVVPKHCIIATNTSAIPIGK
ISEGSSRPENVIGMHYFSPVDKMQLLEIITTDKTSKETAAAAVSLGLKQGKIVIVVKDGP
GFYTTRILSTMLSEAMRLLQEGVNPKQLDTITKSFGFPVGAATLSDEVGIDVGYHIATDL
AKVFGERFSGGDLNVLKSMVDSGFLGRKSGKGYFVYKAGTKSRPENTEAISLLENFKLQP
IGEQSVENQQLRMVSRFVNEAVLCLEESILNSPTEGDIGAVFGLGFPPFSGGPFRWVDWY
GADKLVSKMQTFQNDYGLPFKPCQLLLDHAKDKSKKFYPS
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgtacagacttgtgggtatctcgaacgaaatgtcgctgatcaacgtcaagcga
gccctgacaacaggccggaggttgttaagtcaagatattaaacatacttcatcaaaagtt
attgatgatattttagttataacattaaacaccccaaactcaaaagtaaactccttgtct
catgatgtaatggatgaattacaaactaatttaaacaaagcgagccaagatccatcaatt
aaaggaagtgttataatatctggtaaacctaactgtttcattgctggtgctgatatatct
atgctacaagcatgtcgtactgctgaagaagttcacaaaatatcccatgatggtcaaaac
atacttaatcaagttgaaaaatcaacaaaaccagtagtagcagctataatgggatcgtgt
ttaggaggaggtcttgaagttgcaatggcttgtcattaccgaattgctgtaaaaagtaaa
aacactgctcttggcctgcctgaagttatgttaggattattacccggtggtggtggtact
caacgtttaccaaaattagtagctatgcctactgtattagatatggctctaactggtaaa
tcatatagagctgataaagcattaaaagttggtttgattgatcaacttgtaactcctctt
gggcctggtttaagcaccccaacagaaagaacattagagtatttagaagaaattgctatc
gatgcagccaaaaaattagctgctggtcataaattaacaaaaagaaataagaacaagact
ttgatagataaagtaattgatttagcattacaacaagaatggctacgagaaaaatttttt
gacagtgctaagggcaaggttttaaaaatgaccggaggtctatatcctgctccattaaaa
ataattgatgtcatcaaaactggaattgctcatggcactacaaaaggatatgctgcagag
agtaatggttttgctgaattagctatgacaccacaaagcaaaggtttaattggattattt
caaggccaaactgaatgcaaaaaaaacaaatttggagagcctaaagtggctttaaaaact
gttggtgttcttggtgctggattaatgggtgctggaatagctcatgtgactgttgataaa
ggtctacaagtaatacttaaagacacaaacaaagagggtcttgctaaaggtattgcacaa
attgaaaaaggtcttactggtgcagttaaacgcaagaaattaactgcgatagaaaaagac
agatatgtatctgacttgacaagtacattatcgtatgaatctttttcaaaagctgatatt
gtcatcgaagcagtatttgaaaatataaaaataaagcatcaagttattaaagagcttgaa
caagttgtaccaaaacactgtattattgcaactaacacaagtgccataccaattgggaaa
atatcagagggtagtagccgtcctgaaaatgttattggaatgcattatttctctcccgtt
gataaaatgcaacttttagaaattataacgactgataagacttcaaaagaaacggctgca
gctgccgtatccttaggtttaaaacaaggaaaaattgtaattgtagtaaaagacggccca
ggattctatactacacgaattttgagtaccatgttatcagaagccatgcgattattgcag
gaaggggtaaatccaaaacaattagatacaattactaaaagttttggattcccggtcggt
gctgcaacattatcagatgaagttggtattgatgttggttatcatatagcaactgattta
gcaaaggtgtttggggaacgattcagtggtggtgatcttaatgttttaaaaagcatggtg
gatagtggcttcttaggaagaaaatctggtaaaggttactttgtgtacaaagctggtact
aaaagtagaccagaaaatactgaagctatcagtttgttggaaaatttcaagcttcaaccc
ataggtgaacaatctgttgaaaatcaacaactacgtatggtatccagatttgtaaatgag
gcagttttatgtttggaagaatcaattcttaatagcccgactgaaggtgatattggtgct
gtgtttggtcttggatttcctccgttttctggtggtccattcagatgggttgattggtat
ggtgctgataagcttgtgtcaaaaatgcaaacattccaaaacgattatggtctaccattt
aaaccttgtcaattattgttagatcacgctaaggataaatccaaaaagttttatccatct
taa

DBGET integrated database retrieval system