KEGG   Acyrthosiphon pisum (pea aphid): 100165657Help
Entry
100165657         CDS       T01076                                 

Definition
(RefSeq) trifunctional enzyme subunit alpha, mitochondrial
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00062  Fatty acid elongation
api00071  Fatty acid degradation
api00280  Valine, leucine and isoleucine degradation
api00310  Lysine degradation
api00380  Tryptophan metabolism
api00410  beta-Alanine metabolism
api00640  Propanoate metabolism
api00650  Butanoate metabolism
api01040  Biosynthesis of unsaturated fatty acids
api01100  Metabolic pathways
api01200  Carbon metabolism
api01212  Fatty acid metabolism
Module
api_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
api_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
api_M00085  Fatty acid biosynthesis, elongation, mitochondria
api_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100165657
   00650 Butanoate metabolism
    100165657
  Lipid metabolism
   00062 Fatty acid elongation
    100165657
   00071 Fatty acid degradation
    100165657
   01040 Biosynthesis of unsaturated fatty acids
    100165657
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100165657
   00310 Lysine degradation
    100165657
   00380 Tryptophan metabolism
    100165657
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100165657
Enzymes [BR:api01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     100165657
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100165657
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 UDPG_MGDP_dh_N Sacchrp_dh_NADP 2-Hacid_dh_C MOZART1 NAD_Gly3P_dh_N F420_oxidored
Motif
Other DBs
NCBI-GeneID: 100165657
NCBI-ProteinID: XP_001949325
APHIDBASE: ACYPI006589
UniProt: J9K1G1
Position
Un
AA seq 760 aa AA seqDB search
MALYRLVGISNEMSLINVKRALTTGRRLLSQDIKHTSSKVIDDILVITLNTPNSKVNSLS
HDVMDELQTNLNKASQDPSIKGSVIISGKPNCFIAGADISMLQACRTAEEVHKISHDGQN
ILNQVEKSTKPVVAAIMGSCLGGGLEVAMACHYRIAVKSKNTALGLPEVMLGLLPGGGGT
QRLPKLVAMPTVLDMALTGKSYRADKALKVGLIDQLVTPLGPGLSTPTERTLEYLEEIAI
DAAKKLAAGHKLTKRNKNKTLIDKVIDLALQQEWLREKFFDSAKGKVLKMTGGLYPAPLK
IIDVIKTGIAHGTTKGYAAESNGFAELAMTPQSKGLIGLFQGQTECKKNKFGEPKVALKT
VGVLGAGLMGAGIAHVTVDKGLQVILKDTNKEGLAKGIAQIEKGLTGAVKRKKLTAIEKD
RYVSDLTSTLSYESFSKADIVIEAVFENIKIKHQVIKELEQVVPKHCIIATNTSAIPIGK
ISEGSSRPENVIGMHYFSPVDKMQLLEIITTDKTSKETAAAAVSLGLKQGKIVIVVKDGP
GFYTTRILSTMLSEAMRLLQEGVNPKQLDTITKSFGFPVGAATLSDEVGIDVGYHIATDL
AKVFGERFSGGDLNVLKSMVDSGFLGRKSGKGYFVYKAGTKSRPENTEAISLLENFKLQP
IGEQSVENQQLRMVSRFVNEAVLCLEESILNSPTEGDIGAVFGLGFPPFSGGPFRWVDWY
GADKLVSKMQTFQNDYGLPFKPCQLLLDHAKDKSKKFYPS
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgtacagacttgtgggtatctcgaacgaaatgtcgctgatcaacgtcaagcga
gccctgacaacaggccggaggttgttaagtcaagatattaaacatacttcatcaaaagtt
attgatgatattttagttataacattaaacaccccaaactcaaaagtaaactccttgtct
catgatgtaatggatgaattacaaactaatttaaacaaagcgagccaagatccatcaatt
aaaggaagtgttataatatctggtaaacctaactgtttcattgctggtgctgatatatct
atgctacaagcatgtcgtactgctgaagaagttcacaaaatatcccatgatggtcaaaac
atacttaatcaagttgaaaaatcaacaaaaccagtagtagcagctataatgggatcgtgt
ttaggaggaggtcttgaagttgcaatggcttgtcattaccgaattgctgtaaaaagtaaa
aacactgctcttggcctgcctgaagttatgttaggattattacccggtggtggtggtact
caacgtttaccaaaattagtagctatgcctactgtattagatatggctctaactggtaaa
tcatatagagctgataaagcattaaaagttggtttgattgatcaacttgtaactcctctt
gggcctggtttaagcaccccaacagaaagaacattagagtatttagaagaaattgctatc
gatgcagccaaaaaattagctgctggtcataaattaacaaaaagaaataagaacaagact
ttgatagataaagtaattgatttagcattacaacaagaatggctacgagaaaaatttttt
gacagtgctaagggcaaggttttaaaaatgaccggaggtctatatcctgctccattaaaa
ataattgatgtcatcaaaactggaattgctcatggcactacaaaaggatatgctgcagag
agtaatggttttgctgaattagctatgacaccacaaagcaaaggtttaattggattattt
caaggccaaactgaatgcaaaaaaaacaaatttggagagcctaaagtggctttaaaaact
gttggtgttcttggtgctggattaatgggtgctggaatagctcatgtgactgttgataaa
ggtctacaagtaatacttaaagacacaaacaaagagggtcttgctaaaggtattgcacaa
attgaaaaaggtcttactggtgcagttaaacgcaagaaattaactgcgatagaaaaagac
agatatgtatctgacttgacaagtacattatcgtatgaatctttttcaaaagctgatatt
gtcatcgaagcagtatttgaaaatataaaaataaagcatcaagttattaaagagcttgaa
caagttgtaccaaaacactgtattattgcaactaacacaagtgccataccaattgggaaa
atatcagagggtagtagccgtcctgaaaatgttattggaatgcattatttctctcccgtt
gataaaatgcaacttttagaaattataacgactgataagacttcaaaagaaacggctgca
gctgccgtatccttaggtttaaaacaaggaaaaattgtaattgtagtaaaagacggccca
ggattctatactacacgaattttgagtaccatgttatcagaagccatgcgattattgcag
gaaggggtaaatccaaaacaattagatacaattactaaaagttttggattcccggtcggt
gctgcaacattatcagatgaagttggtattgatgttggttatcatatagcaactgattta
gcaaaggtgtttggggaacgattcagtggtggtgatcttaatgttttaaaaagcatggtg
gatagtggcttcttaggaagaaaatctggtaaaggttactttgtgtacaaagctggtact
aaaagtagaccagaaaatactgaagctatcagtttgttggaaaatttcaagcttcaaccc
ataggtgaacaatctgttgaaaatcaacaactacgtatggtatccagatttgtaaatgag
gcagttttatgtttggaagaatcaattcttaatagcccgactgaaggtgatattggtgct
gtgtttggtcttggatttcctccgttttctggtggtccattcagatgggttgattggtat
ggtgctgataagcttgtgtcaaaaatgcaaacattccaaaacgattatggtctaccattt
aaaccttgtcaattattgttagatcacgctaaggataaatccaaaaagttttatccatct
taa

DBGET integrated database retrieval system