KEGG   Acyrthosiphon pisum (pea aphid): 100165838Help
Entry
100165838         CDS       T01076                                 

Definition
histone acetyltransferase KAT2B-like
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:api04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 764 aa AA seqDB search
MPKSLKLERCLPSTSSASGVLLPDHYVENDPIIQTILEFKASECKLSRHEKLVKLSSKSS
CQVSTCQCSGWRGRRDNRMMSSTCTKSGCSHPLSSHVSHLESAKDEQLNTLLELVFDLDN
LSVTVNKDLKKPNIERNYVQEDTYSAVYHELRSFVYPGSCITLDKLFGTPPFENPNIVKA
LMNFNMYKFGHDSSQLKIALKISKFLTKHFDLWKWISPKELPHCKTFQHRKNYEFYYQRY
LVFCLLPKYLHSIAPSYKMSLIFGQDILKYTLKAFRMHLTDWCHASAPKWSNHRKHFCLS
YLPKYMNLLEEEVYAVHSPIWDLHFKDSDLKKIILTESLDSGLDETKEAEHKDRRKKDKH
PNEDMSMKPNEKHSIEDALSEDKIMDILKNVQSGPITYSKEFGLETGPRGHQARTEEEHG
IIRFVVIGNSLDSRVEKSTMLWLMQLRNLFRTQLPRMPVRYITRLVFDTKHKTLALLKDG
VPIGGICFCPFVSQGFTEIVFCAVKVDQQENGYGTQLMNHLKDYHIQHNILNFLTYADKL
AIEYFKKQGFSQDVRISKKIHQEYIKHYQGAILMHCELNPKIIYTQLTSVIRIQKEIVKS
LVEEKHMKIERHYPGLTCFLDGVRMVTIESIPGVMDTGWTPSTRATRNSRVTEETTDIDV
LAKHLKKVLQFVKNNALSEPFLNPVDKKVPGYYELIKYPMDLSTIGKRLASGYYVTRKLF
IADMRRMFSNCKTFNPEDSYWANCAVELERLFQIKMKEMGLWDY
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagtcgctgaaactcgaaagatgtctgccgtcaacatcgtccgcgtcgggcgtg
ctgttgcccgaccactatgtcgagaacgatccaatcatacaaacaattcttgaattcaaa
gcatcagaatgcaaattgtccaggcacgagaaactggtgaagctatccagtaaatcctcc
tgtcaggtttcaacttgccaatgtagtggatggcgaggtaggcgtgataatcgtatgatg
tcttcaacttgcacaaaatctggttgcagtcatcctctatcttctcacgtatcacattta
gaaagtgccaaggatgaacagctaaacaccttactagaattagtatttgatctcgataat
ttatcagtcactgtaaataaagatttaaaaaaaccaaatattgagagaaattatgtgcaa
gaagacacttatagtgcagtttatcatgaattacgaagttttgtataccccggatcttgt
atcacacttgataaattattcggaactccgccatttgaaaatccaaacatagttaaagct
ttaatgaactttaatatgtataagtttggtcatgacagctctcaactaaaaattgcttta
aaaatcagtaaatttttaacaaaacattttgatctttggaaatggatttctcctaaggaa
ttaccacattgtaaaacatttcaacataggaaaaattatgaattctactatcaaagatat
ttagtattttgtctactcccaaaatatcttcattcaattgcaccaagttataaaatgagt
ttgatatttggtcaagacattcttaagtatacattaaaagcatttagaatgcatttaaca
gactggtgtcatgcatcagctccaaaatggtcaaatcatcgaaaacatttttgcctgagc
tatttgcccaaatatatgaatttattagaagaagaagtgtatgctgttcattcaccaata
tgggatttgcattttaaagattctgatctaaaaaaaattattctaacggagtccttggac
tccgggctagacgaaaccaaggaggcagaacataaagatcgtagaaaaaaagataaacat
ccgaatgaagatatgtcaatgaaaccaaatgaaaaacatagtattgaagatgctttatca
gaagacaaaattatggatattctaaaaaatgttcaaagtgggcctatcacttactctaag
gagtttggattagaaaccggacctcgaggccatcaagctcgaacagaagaagagcatgga
attatacgtttcgtagtgataggtaattcattagactcaagagttgaaaaaagtactatg
ttatggcttatgcaactaagaaatttgtttcgaactcaattgccaagaatgccagttaga
tacattactcgattagtatttgatacgaaacacaagacattagctttgttgaaagatggc
gttccaattggtggtatatgtttttgtccatttgtctctcaaggtttcacagaaatagtg
ttctgtgcagtcaaagttgatcaacaagaaaatggatatggaacacaactaatgaatcat
ttaaaggattatcatattcagcataatatacttaattttcttacttatgctgataaactt
gctattgaatattttaagaaacaagggtttagccaagatgtgagaatatcgaagaaaata
catcaagaatatattaaacattatcagggtgcaatattgatgcattgtgaactaaaccca
aaaattatttatactcaattaacatcagtgatacgtatacaaaaagaaatagttaagagt
ttagtggaagaaaaacacatgaaaatagaaaggcattacccaggcctaacatgtttctta
gatggtgtacgcatggtcacaattgaatcaatacccggtgtcatggatactggttggaca
ccatccactcgagctacaagaaatagtcgtgtcacggaagaaacaactgatattgatgtc
ttagctaaacacctaaaaaaagttttgcaatttgtcaaaaacaatgcattgtctgaacca
tttttgaatccagttgataaaaaagttcctggttactatgagcttataaagtatcccatg
gacttgagtacaattggtaagcgattagcttcaggctactatgtaactagaaagttgttt
attgctgatatgagacgaatgtttagcaactgtaaaacatttaacccagaagattcatat
tgggcaaactgtgcagtcgaattggaaagacttttccagattaaaatgaaagaaatggga
ctctgggattactaa

DBGET integrated database retrieval system