KEGG   Acyrthosiphon pisum (pea aphid): 100165838Help
Entry
100165838         CDS       T01076                                 

Definition
histone acetyltransferase KAT2B-like
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:api00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100165838
Enzymes [BR:api01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100165838
Transcription machinery [BR:api03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100165838
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 764 aa AA seqDB search
MPKSLKLERCLPSTSSASGVLLPDHYVENDPIIQTILEFKASECKLSRHEKLVKLSSKSS
CQVSTCQCSGWRGRRDNRMMSSTCTKSGCSHPLSSHVSHLESAKDEQLNTLLELVFDLDN
LSVTVNKDLKKPNIERNYVQEDTYSAVYHELRSFVYPGSCITLDKLFGTPPFENPNIVKA
LMNFNMYKFGHDSSQLKIALKISKFLTKHFDLWKWISPKELPHCKTFQHRKNYEFYYQRY
LVFCLLPKYLHSIAPSYKMSLIFGQDILKYTLKAFRMHLTDWCHASAPKWSNHRKHFCLS
YLPKYMNLLEEEVYAVHSPIWDLHFKDSDLKKIILTESLDSGLDETKEAEHKDRRKKDKH
PNEDMSMKPNEKHSIEDALSEDKIMDILKNVQSGPITYSKEFGLETGPRGHQARTEEEHG
IIRFVVIGNSLDSRVEKSTMLWLMQLRNLFRTQLPRMPVRYITRLVFDTKHKTLALLKDG
VPIGGICFCPFVSQGFTEIVFCAVKVDQQENGYGTQLMNHLKDYHIQHNILNFLTYADKL
AIEYFKKQGFSQDVRISKKIHQEYIKHYQGAILMHCELNPKIIYTQLTSVIRIQKEIVKS
LVEEKHMKIERHYPGLTCFLDGVRMVTIESIPGVMDTGWTPSTRATRNSRVTEETTDIDV
LAKHLKKVLQFVKNNALSEPFLNPVDKKVPGYYELIKYPMDLSTIGKRLASGYYVTRKLF
IADMRRMFSNCKTFNPEDSYWANCAVELERLFQIKMKEMGLWDY
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagtcgctgaaactcgaaagatgtctgccgtcaacatcgtccgcgtcgggcgtg
ctgttgcccgaccactatgtcgagaacgatccaatcatacaaacaattcttgaattcaaa
gcatcagaatgcaaattgtccaggcacgagaaactggtgaagctatccagtaaatcctcc
tgtcaggtttcaacttgccaatgtagtggatggcgaggtaggcgtgataatcgtatgatg
tcttcaacttgcacaaaatctggttgcagtcatcctctatcttctcacgtatcacattta
gaaagtgccaaggatgaacagctaaacaccttactagaattagtatttgatctcgataat
ttatcagtcactgtaaataaagatttaaaaaaaccaaatattgagagaaattatgtgcaa
gaagacacttatagtgcagtttatcatgaattacgaagttttgtataccccggatcttgt
atcacacttgataaattattcggaactccgccatttgaaaatccaaacatagttaaagct
ttaatgaactttaatatgtataagtttggtcatgacagctctcaactaaaaattgcttta
aaaatcagtaaatttttaacaaaacattttgatctttggaaatggatttctcctaaggaa
ttaccacattgtaaaacatttcaacataggaaaaattatgaattctactatcaaagatat
ttagtattttgtctactcccaaaatatcttcattcaattgcaccaagttataaaatgagt
ttgatatttggtcaagacattcttaagtatacattaaaagcatttagaatgcatttaaca
gactggtgtcatgcatcagctccaaaatggtcaaatcatcgaaaacatttttgcctgagc
tatttgcccaaatatatgaatttattagaagaagaagtgtatgctgttcattcaccaata
tgggatttgcattttaaagattctgatctaaaaaaaattattctaacggagtccttggac
tccgggctagacgaaaccaaggaggcagaacataaagatcgtagaaaaaaagataaacat
ccgaatgaagatatgtcaatgaaaccaaatgaaaaacatagtattgaagatgctttatca
gaagacaaaattatggatattctaaaaaatgttcaaagtgggcctatcacttactctaag
gagtttggattagaaaccggacctcgaggccatcaagctcgaacagaagaagagcatgga
attatacgtttcgtagtgataggtaattcattagactcaagagttgaaaaaagtactatg
ttatggcttatgcaactaagaaatttgtttcgaactcaattgccaagaatgccagttaga
tacattactcgattagtatttgatacgaaacacaagacattagctttgttgaaagatggc
gttccaattggtggtatatgtttttgtccatttgtctctcaaggtttcacagaaatagtg
ttctgtgcagtcaaagttgatcaacaagaaaatggatatggaacacaactaatgaatcat
ttaaaggattatcatattcagcataatatacttaattttcttacttatgctgataaactt
gctattgaatattttaagaaacaagggtttagccaagatgtgagaatatcgaagaaaata
catcaagaatatattaaacattatcagggtgcaatattgatgcattgtgaactaaaccca
aaaattatttatactcaattaacatcagtgatacgtatacaaaaagaaatagttaagagt
ttagtggaagaaaaacacatgaaaatagaaaggcattacccaggcctaacatgtttctta
gatggtgtacgcatggtcacaattgaatcaatacccggtgtcatggatactggttggaca
ccatccactcgagctacaagaaatagtcgtgtcacggaagaaacaactgatattgatgtc
ttagctaaacacctaaaaaaagttttgcaatttgtcaaaaacaatgcattgtctgaacca
tttttgaatccagttgataaaaaagttcctggttactatgagcttataaagtatcccatg
gacttgagtacaattggtaagcgattagcttcaggctactatgtaactagaaagttgttt
attgctgatatgagacgaatgtttagcaactgtaaaacatttaacccagaagattcatat
tgggcaaactgtgcagtcgaattggaaagacttttccagattaaaatgaaagaaatggga
ctctgggattactaa

DBGET integrated database retrieval system