KEGG   Acyrthosiphon pisum (pea aphid): 100166026Help
Entry
100166026         CDS       T01076                                 

Definition
putative glycogen [starch] synthase-like
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100166026
Enzymes [BR:api01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100166026
Glycosyltransferases [BR:api01003]
 Polysaccharide
  Storage polysaccharide
   100166026
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 673 aa AA seqDB search
MYAKTEIMFGLVHPFVTKQWKFDNSNTVKLLSSLRIEDRDQFEFGMVNFDWKSYIKTYYY
GIRKHILKEEISNLDKAISKNRKYLLTGRWLVDGSPQVILFDIGSAAWKLDEYKQTLWDT
CNIGIPHLDIEANDAVILGYLISEFLSEFRVAAAAYIDSTPLVVAHFHEWQAGIGLIALR
TKKEPIATVFTTHATLLGRYLCAGNTDFYNNLDKFNLDEEAGKRQIYHRYCMERAAAHVA
HVFTTVSDITGKESEYLLSRKPDIITPNGLNVVKFSALHEFQNLHSLSKEKIHDFVRGHF
HGHYNFDLEKTLYFFTAGRYEFSNKGADIFIEALARLNHYLKNANSDMTVVAFLIFPART
DNFNVESLRGHAVTKSLRDTILEIQTKVGRRIYEICLRGRMPVEEELLNKEDTVRLKRCL
YALQRDDLPPVTTHNVVNDWCDPVLNTIRRCKLFNTTADKVKIVFHPEFLSSTNPLFGLD
YEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSITTNLSGFGCFMAQHIADPLSYGIYI
VDRQNISIEESVRQLAQYMYDFARMSRRQRVIQRNRTERLSDLLDWRNLGIYYRQARLKA
LCQVFPDMFDKETETLCITEASRRRYNYPRPYSEPPSPSNSRPTTPGASLHGSDDEDIDD
ERELAELSEHISH
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgtatgcgaaaacagaaattatgtttggtttagttcacccgtttgttacgaaacaatgg
aaatttgacaacagcaataccgtcaaactgttatcgtcactaaggatagaagaccgcgac
caatttgagttcggcatggtcaatttcgactggaaatcatatataaaaacctattactac
gggattagaaaacacatactaaaagaagaaattagtaacctggacaaagcgatatctaaa
aaccggaagtatttgttgacaggtcgatggttagtcgatggtagtccacaagttatattg
tttgacattggttcagctgcatggaaattagacgaatacaagcaaaccttatgggatacg
tgtaacataggaattccacatttagacatagaagcaaacgatgccgtaattttgggatat
ttaatatcagaatttctttcagaattccgtgtggcagcagcagcatacattgattcaacg
ccattggttgttgctcattttcacgaatggcaagctggcatagggttgatagcattacgt
acaaaaaaagaaccaatcgctacagtatttacaactcatgccacattattaggtcgatac
ctctgtgctggaaatactgacttctacaataatttagataaattcaatctcgatgaagaa
gctggtaaaagacaaatttatcaccgttattgtatggaacgagctgcagcacatgttgca
cacgtttttaccacagtatctgatattaccggaaaagaatccgagtacttactctcccgg
aagcctgatattataactcccaatgggttaaacgttgtcaaattttcagcattacatgaa
tttcaaaatcttcattcgctatccaaagagaagattcacgattttgtccgcggccatttc
catggacattataattttgatctggagaagacgttatatttctttactgctggaagatat
gaattttctaacaaaggagcagacatatttatcgaagcattagctcgtttaaatcactat
ttgaaaaatgccaattccgatatgactgtcgttgccttccttatattccccgcacgaacg
gataacttcaacgtggaaagtctccgtggtcatgcagttaccaaaagcttacgagacacc
atactagaaatacaaaccaaagtcggccgaaggatttacgaaatttgtttaaggggacga
atgcctgtcgaagaagagttgttgaacaaagaagacaccgtcaggttgaaacggtgtctg
tacgctttacagagagacgacttgccaccggtaaccactcataacgtagtaaatgattgg
tgcgatcccgtactgaacacgatacggagatgtaagctgttcaacaccacagccgacaaa
gttaaaattgtattccacccggaatttttgtcctcgactaacccgttgtttggattggac
tatgaggaattcgtgcgcggttgtcacttgggagtattccccagctactacgaaccttgg
ggatacacccccgccgaatgcacagtcatgggaatcccgtcaattactacaaacttgtcg
ggtttcggttgttttatggcccagcacatcgctgatcctttaagttatggaatttacatc
gtggaccgtcaaaacatcagcatcgaagaatctgtcagacaactcgcgcagtatatgtac
gattttgcgaggatgagccgtagacaacgagtgatccagcgaaaccgtacagaacggtta
agcgatttgctcgattggcgtaatttgggtatttattatcgtcaagccaggttgaaggca
ttatgtcaagtgttcccggatatgtttgataaagaaacagaaacgttatgcatcacagaa
gcatcgagacgtcgatacaactatcctcgtccttattctgaaccaccgtcaccatcgaat
agccgaccgaccacacctggagcttcactacacggttcagatgacgaagatattgatgat
gagcgtgagcttgcagagctttcggaacatataagtcattaa

DBGET integrated database retrieval system