KEGG   Acyrthosiphon pisum (pea aphid): 100166141Help
Entry
100166141         CDS       T01076                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 46
  KO
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100166141
Peptidases [BR:api01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100166141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 385 aa AA seqDB search
MGGNVSQLERDIGSDQFPPNEHYFGLVNFGNTCYSNSVLQALYFCKPFRDKVLEYKARNK
RNKETLLTCLADLFHSIATQKKKVGSIAPKKFINRLRKEKEEFNNYMQQDAHEFLNFLIN
HINEIILSERNQTNCNGKSKSITPNIVDGESTTSSITSSSSHNQDPTWVHEIFQGILTSE
TRCLNCEEVSSKDEDFFDLQVDIDQNTSITHCLRCFSNTEMLCSDNKFKCDNCCSYQEAQ
KCMRVKKLPMILALHLKRFKYMEQFNRHIKVSHRVVFPLELRLFNTSDDAVNPDRMYNLV
AVVIHCGSGPNRGHYISIVKSHDFWLLFDDDMVDKIDQSAIEDFYGLTSDLQKSSETGYI
LFYQSRDAAEISKSGMADSKSSHCK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgggcggtaatgtgtcacaactagaaagagatatcggatcagatcagtttcctccaaat
gagcattattttggtttagttaattttggaaatacatgttacagtaattcagttcttcaa
gctctttatttttgtaaaccttttcgagacaaagtattagaatacaaagctcgtaataag
agaaataaagaaacattgctcacatgtttagctgatctatttcatagcattgcaactcaa
aaaaagaaagttgggtccatagcccccaaaaaatttattaatagacttcgaaaagaaaaa
gaagaattcaataactatatgcaacaagatgctcatgaatttttaaacttccttataaat
catattaatgagattattctttccgaacgtaaccaaacaaattgtaatggtaaatctaaa
tcaattacacctaatattgttgatggagaatcaactactagtagcatcactagctcaagt
agtcataatcaagatccaacttgggtacatgaaatatttcaagggatactaacgagtgaa
actagatgtttaaactgtgaagaagtcagcagtaaagatgaagactttttcgacctccaa
gtagatatagatcaaaatactagtattacacattgtttacgttgttttagcaatacagaa
atgctttgtagtgataataaatttaagtgtgacaattgctgtagctatcaagaagcccag
aaatgtatgcgggtcaaaaaattacccatgatattggcattgcatttgaaaagattcaaa
tacatggaacaatttaataggcatataaaagtatctcatagagttgttttccctttagaa
cttagattatttaatacgtctgatgatgctgttaatccagacagaatgtacaatcttgta
gctgtagttatacattgtggcagtgggccaaatagaggtcattacattagcatagttaaa
agtcatgatttttggctactgtttgacgatgatatggttgataaaattgatcaatctgct
attgaagatttctatggtctcacgtcagacttacagaaatcgtcagaaactggttatata
cttttttatcaatctagagatgctgctgaaatatcaaaatctggtatggctgattcaaaa
tcaagtcattgtaaatga

DBGET integrated database retrieval system