KEGG   Acyrthosiphon pisum (pea aphid): 100166141Help
Entry
100166141         CDS       T01076                                 

Definition
ubiquitin carboxyl-terminal hydrolase 46-like
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
api  Acyrthosiphon pisum (pea aphid)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 385 aa AA seqDB search
MGGNVSQLERDIGSDQFPPNEHYFGLVNFGNTCYSNSVLQALYFCKPFRDKVLEYKARNK
RNKETLLTCLADLFHSIATQKKKVGSIAPKKFINRLRKEKEEFNNYMQQDAHEFLNFLIN
HINEIILSERNQTNCNGKSKSITPNIVDGESTTSSITSSSSHNQDPTWVHEIFQGILTSE
TRCLNCEEVSSKDEDFFDLQVDIDQNTSITHCLRCFSNTEMLCSDNKFKCDNCCSYQEAQ
KCMRVKKLPMILALHLKRFKYMEQFNRHIKVSHRVVFPLELRLFNTSDDAVNPDRMYNLV
AVVIHCGSGPNRGHYISIVKSHDFWLLFDDDMVDKIDQSAIEDFYGLTSDLQKSSETGYI
LFYQSRDAAEISKSGMADSKSSHCK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgggcggtaatgtgtcacaactagaaagagatatcggatcagatcagtttcctccaaat
gagcattattttggtttagttaattttggaaatacatgttacagtaattcagttcttcaa
gctctttatttttgtaaaccttttcgagacaaagtattagaatacaaagctcgtaataag
agaaataaagaaacattgctcacatgtttagctgatctatttcatagcattgcaactcaa
aaaaagaaagttgggtccatagcccccaaaaaatttattaatagacttcgaaaagaaaaa
gaagaattcaataactatatgcaacaagatgctcatgaatttttaaacttccttataaat
catattaatgagattattctttccgaacgtaaccaaacaaattgtaatggtaaatctaaa
tcaattacacctaatattgttgatggagaatcaactactagtagcatcactagctcaagt
agtcataatcaagatccaacttgggtacatgaaatatttcaagggatactaacgagtgaa
actagatgtttaaactgtgaagaagtcagcagtaaagatgaagactttttcgacctccaa
gtagatatagatcaaaatactagtattacacattgtttacgttgttttagcaatacagaa
atgctttgtagtgataataaatttaagtgtgacaattgctgtagctatcaagaagcccag
aaatgtatgcgggtcaaaaaattacccatgatattggcattgcatttgaaaagattcaaa
tacatggaacaatttaataggcatataaaagtatctcatagagttgttttccctttagaa
cttagattatttaatacgtctgatgatgctgttaatccagacagaatgtacaatcttgta
gctgtagttatacattgtggcagtgggccaaatagaggtcattacattagcatagttaaa
agtcatgatttttggctactgtttgacgatgatatggttgataaaattgatcaatctgct
attgaagatttctatggtctcacgtcagacttacagaaatcgtcagaaactggttatata
cttttttatcaatctagagatgctgctgaaatatcaaaatctggtatggctgattcaaaa
tcaagtcattgtaaatga

DBGET integrated database retrieval system