KEGG   Acyrthosiphon pisum (pea aphid): 100166249Help
Entry
100166249         CDS       T01076                                 

Definition
protein O-mannosyl-transferase 2
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    100166249
Enzymes [BR:api01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     100166249
Glycosyltransferases [BR:api01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   100166249
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 604 aa AA seqDB search
YVGMREFCTILGGALIPFTFISIWEMTHSLNAATLSASLVLFDVGTLTLTQYILLDPILL
FFMLASFVGICKFRSAALSEFRVNWWFWLIFTGVTMACCVCVKFVGLFQVTFIGLMTIVD
LWFILGKLSKPISYTVKHFVARFVCLIILPILVYVGFFYIHLFILNKSGNGDGFYSSAFQ
SKLQGNSLHNASMPKDVSFGAIVTLKNHRTGGGYLHSHWHLYPENVGAKQQQITTYAHKD
ENNRWLVKLYNDDEKINFNDTVRYIKHGDMIRLEHVPTRRNLHSHREPAPITKKHYQVTG
YGENGTGDYNDVWKVFVDGGSDGNVVSAVTSKIKLVHVLQHCVLTTSNKQLPKWAFEQHE
VTCSPNLRDTNSYWNVEDNINPKLPNVSFEVYSPNFFARFIESHAVMFQGNAGLKPKEGE
VTSKPWQWPINYKGQFFSGNNYKIYLLGNPVIWWGNIVVMVLYNLISVWKAIINKRRNNQ
NEAVADSNQQLLTTCNWLFIGWGLHYIPFYAMGRVLYFHHYFSAFLYSSMLTGVTISYLL
EIIKTSKPTLIRKTIYDGLIGLIYASAIYSFYLYSPLAYGMSGPVSTEQNSTMFGLRWLD
SWEF
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
tacgttggaatgcgagagttttgtacaattttaggtggagctttaataccattcacgttt
atatctatttgggaaatgacacattcgttaaatgcggcaactttatcagcttctttagta
ctatttgatgttggaacattaacattaactcaatatattttgctcgatcccatactgttg
ttctttatgttagcatcatttgtagggatttgcaaatttcggtctgctgctttatctgaa
tttagagttaattggtggttttggttaatatttactggtgtaaccatggcctgttgtgta
tgtgttaagtttgttggattatttcaagtgacatttattggattgatgacaatagttgat
ctatggtttatacttggaaaactttcaaagccaataagttatactgtgaaacattttgta
gcaagatttgtttgtcttataattttaccaatactagtgtatgttggatttttttacata
catctatttatactcaataaaagtggtaatggcgatggtttctatagttctgcttttcaa
tcaaaattacaaggaaattcattacacaacgctagtatgccaaaagatgtatcatttggg
gcaatagtaacattaaaaaatcatagaactggtggtggatatttacattcacattggcat
ctttatccagagaatgttggggccaaacaacaacagattactacttatgcgcataaagac
gaaaacaatcgatggttagtaaaactttacaatgatgatgaaaaaataaatttcaatgac
actgtaagatatataaaacatggagatatgataagactggaacatgtaccaacaaggcga
aatttacattcacaccgcgaaccggctccgataacaaaaaaacattatcaagtcaccggt
tatggagagaatggaactggtgattacaatgatgtttggaaagtatttgtcgatggtggt
tcagatggtaatgttgtctcagcagtaacaagtaaaatcaaattagttcatgttcttcaa
cattgtgtgctcacaacaagtaacaagcaattgcctaaatgggcatttgaacagcatgaa
gtcacatgtagtccaaatctaagggatacaaattcatattggaatgtcgaggataacata
aatcctaagcttccaaatgtcagttttgaagtatattccccaaatttctttgccagattc
attgaatcacatgctgttatgttccaagggaatgctggtcttaaaccaaaggaaggagaa
gtaacatctaagccatggcaatggccaataaactataagggacaattcttttctggtaac
aattataaaatttatttgcttggaaacccagttatatggtggggaaatatagtggttatg
gtactgtacaatttaatttcagtttggaaagccattatcaataaacgcaggaataatcaa
aatgaagctgttgcagattctaatcaacagttactgaccacttgtaactggctatttatt
ggatggggactacactatataccgttttacgcaatgggtagagtcttgtacttccatcac
tatttttcagcatttttatatagctcaatgttaacaggtgtaactatcagttatttattg
gaaataattaagacatccaagccaactcttattcggaaaacaatttatgatggactcatt
ggacttatctatgcatcggccatttatagtttttatctatactctcctcttgcttatggt
atgtcaggaccagtttccacagaacaaaatagtacaatgtttggattacgctggcttgat
tcttgggaattctag

DBGET integrated database retrieval system