KEGG   Acyrthosiphon pisum (pea aphid): 100166307Help
Entry
100166307         CDS       T01076                                 

Definition
Pyruvate dehydrogenase [lipoamide] kinase-like
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
api  Acyrthosiphon pisum (pea aphid)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 404 aa AA seqDB search
MRLIGYRLAKNLEKMVDFYSQFNPSSLSIKQFIDFGLKANEQKSYQFLKKELPVRLANIM
KEIHLLPDNLLKMPSVNLVNNWYAQSFNEMIEFEVDDGCTEQTLNKFCQILVKIRNRHSD
VVQTMAQGVLELKDSHEIDLHTENSIQYFLDRFYMSRIGIRMLINQHTLLFGDHINNNNH
HQHIGCIDPYCDVISVVKDAYENARFLCDQYYLTSPELEICKSIDADDEPIKIVYVPSHL
YHILFELFKNSMRATVEHHKTDILPPLHVTIVKGKEDVCVKVSDQGGGIPRSLSERMFHY
MYSTAPQPSKSDAHTVPILGYGYGLPISRLYARYLHGDLVLLSCDGFGTEAIIYLKALSN
EANELLPIYNKMSTRFYKTTDHTIDWRSTCNHTPISQQQFTQTQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgattggttatagactggccaaaaatctggagaaaatggtcgatttctactcg
cagtttaatccatcatcattatccattaaacagttcattgactttggtttaaaggcaaat
gaacaaaaatcatatcaatttttaaagaaagaactacccgttcgtttggcaaatattatg
aaagaaattcacttgctaccagataatttgttgaaaatgccatctgtgaatttagtgaat
aattggtacgcacaatctttcaatgaaatgattgaatttgaagtcgatgatggatgtact
gaacaaactttaaacaaattttgtcaaatattagtaaaaattcgtaatcgtcattcagat
gttgtccaaacaatggcacaaggggttttagagctgaaagattcacatgaaatcgatttg
catactgaaaacagcattcaatattttcttgatcgtttttatatgtctcgaattggtatt
cgtatgcttattaaccagcatacattattatttggtgaccatataaacaataataaccat
catcaacatattggttgtattgatccttattgtgatgtaataagcgttgtgaaagatgca
tacgagaatgctagatttttgtgtgaccaatattatttgacctcacctgaattagaaatc
tgtaaaagtattgatgctgatgatgagccaattaaaattgtttatgtgccatcacatttg
tatcatattctatttgaattattcaaaaattcaatgagagctactgttgagcatcataag
actgatattctaccaccattgcatgtaacaatcgtaaaaggaaaagaagatgtctgtgtt
aaagtgtctgatcaaggtggtggcattccaaggagtttgagtgaacgcatgtttcactat
atgtattcaactgcaccacaaccttcaaaatcagatgcacatacagtgccaattttaggg
tatggttatggacttcctatttctaggctttacgctagatatttgcacggagatttagtt
ttgttgtcttgtgatggatttggtaccgaagccattatttacttgaaagctttatcaaat
gaagctaatgagttgttgccaatatacaataagatgtcaaccaggttttataaaacaact
gatcacactattgattggagaagtacttgcaatcacacaccgatcagtcagcaacaattc
acacaaacacaatga

DBGET integrated database retrieval system