KEGG   Acyrthosiphon pisum (pea aphid): 100166363Help
Entry
100166363         CDS       T01076                                 

Definition
dopamine beta-hydroxylase-like
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100166363
Enzymes [BR:api01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     100166363
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 606 aa AA seqDB search
MKQQRSASQQPLRWCRRWTAVVAAIVTLFSATDGGHAGAAGRRVYTAPLDDTGRTAVYWT
VDYGSQSVKFEAHFAAGGGPFDWLAVGFSGRGNHSGADFCVMWVDWNKNIFIQDTWTDDA
GRISVDERQDCEEFDVARFHGGGTALTFTRKFDTCDDDRDYLIQDGTTHLVWMVGGGPLF
AVEGLLVSQARAKGMQRVQLLKPERPQVRLPDKVSKIDVLASKVNVPAEETTYWCHVMKI
PLDLSFKHHIVRFESVIDESSRGVVHHMEVFHCESSAGTRIPLYSGPCFSEKRPYKTQVC
KKVMAAWAMGAAPFVYPEEAGLPIGGPDFNSYIMLEVHYNNPGLRKGMVDSSGVRLYITP
EVRKYDAGVIELGLEYTDKMAIPPKLEDFTLSGYCIAECTAVSIPSAGIEIFGSQLHTHL
TGTMIYTKHVRDGQELPELNRDNHYSTHFQEIRLLHKPVRVLPGDALITTCHYNTEDRQN
ITLGGFSITDEMCVNYVYYYPKIELEVCKSSISDQNLKSYFKFLNEWERQRTSPERAVSV
NYNGAEWTPMRSRVLHQVYEQSTLSMQCNRSTGERFPGDWENRPSTKVLYTLPPPARSCS
RLTPSS
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacagcggtccgcttcgcagcaaccgctgcggtggtgccgccgatggacggcc
gttgtagcagccatcgtcacccttttctcggccacagatggtggccacgcaggggccgct
ggacgccgtgtgtacaccgcaccgctggacgacacgggccggacggctgtctactggacg
gtcgactacggatcgcagtccgtcaagttcgaagcgcacttcgcggccggcggcggcccg
ttcgactggctggcggtgggcttctcgggccgcggcaaccactcgggagccgacttctgc
gtcatgtgggtcgactggaacaaaaatatttttattcaggatacgtggacagatgacgcc
ggaagaatttccgtagatgagcgacaggattgtgaagagttcgatgttgctcgatttcac
ggaggaggtactgctttgacatttactcgaaaatttgatacatgtgatgacgaccgcgat
tatttaatccaggatggtactactcaccttgtatggatggtaggcggcggtccactattt
gcagttgaagggctgttggtgtcgcaggccagagcgaagggcatgcaaagggttcagttg
ctaaaaccggaaagaccgcaggtccgattgccggataaagtgtccaaaatagacgtgttg
gcttccaaggtaaacgttcccgcggaagagacgacgtattggtgtcacgtgatgaagatt
cctctggatttatcgttcaaacatcatatcgtcaggtttgagtcggttattgacgaaagt
agtcgaggtgtagtgcatcacatggaggtgttccattgcgaatccagtgctggcactcgg
ataccattgtacagtggtccttgtttttcggaaaaacggccgtacaagacacaagtgtgc
aagaaagtgatggccgcctgggccatgggagctgctcctttcgtgtaccccgaggaagcc
ggtttacccatcggaggtcccgatttcaatagctatatcatgttggaggtgcactacaac
aatcccggattaagaaaaggcatggtggacagttccggcgtacgattgtacataacgccg
gaagtgagaaaatacgacgccggagtgatcgaactgggcctagagtacacagacaaaatg
gccataccgccgaagttggaggatttcacgttgagcggctattgtattgctgaatgcacc
gcagtgagtatcccttcggctgggattgagatctttggttcacaattgcacactcacctt
actggcaccatgatctacacgaaacacgtacgagacggacaggaactaccggaactcaac
agggacaatcattacagcacgcattttcaggaaattcgtttacttcataaaccggtgcga
gtgcttcctggggatgcattaataactacgtgtcattacaacaccgaagacagacaaaat
attacacttggaggattcagcattaccgacgaaatgtgcgtcaactacgtgtattactat
ccgaagatagagttagaggtgtgcaagagttcaataagtgaccaaaacctcaagagctat
ttcaaatttctgaacgagtgggagaggcagcggacgtcgccagagcgggcggtgagcgtc
aactacaacggggccgagtggacgccgatgcggagtcgagtgctgcaccaggtgtacgaa
cagagcacgctgtccatgcagtgcaacaggagcacaggcgaacggttccctggtgactgg
gagaacaggccgtccactaaagtgctgtacacgctgccaccgccggctaggagctgcagt
agacttacgccgtcctcataa

DBGET integrated database retrieval system