KEGG   Acyrthosiphon pisum (pea aphid): 100166481Help
Entry
100166481         CDS       T01076                                 

Definition
ubiquitin carboxyl-terminal hydrolase 36-like
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100166481
Peptidases [BR:api01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100166481
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 765 aa AA seqDB search
MLDKRIEFEMLDHKPSMLSQMKNKIIMLLQNDCSKKDMIKKNERLNGDTNKISHLPNPKV
VLYPPERVQLGWQDKKMSVGSGLDNPGVICYINSTLQALFHIPAFTNWLMSDGQHQKTCQ
KKTGFQKDCIVCMVCNTFKLSKKLTGSSFKASIITNRLSLICKHLSTYRQEDAHEFLRYL
IESMEQCYLSAFGPAAKSLDNYSKETTPINQIFGGYMRTEVMCGKCGHISTTFQHFQDLI
LDIRHSDNVNDALDNYFKKEPLDESYLCEICQRQVAADKKFSIERAPNVLCIQLKRYSIG
MDGYSGNKNSKAIQINERLDLSSYQFDHHTFKIDVRPLRYHLVSMIIHYGSSLHCGHYTT
LGLTPSGSYYCFNDSNVYRTNFKNYSTSNDSYIIFYELEPSGNMNNTNLERKTSTVTSTS
TCKPSVNGFFPNKRNGVEKPLNGVTKPLNKSSDNENSSLSGEDNASAPVILGKVKQSTDQ
RVPDKKPLVMRPKDDPSGVATETPIKCIVLKPPKDDSPINERDKEILSAKKCLVLKPKDE
EPLEVKPEPEPVTKCLVRISKDDNESSNTTKASHSTEGKDSEKKNRRRENGILKLDVNKP
KARPDHNYNGTKSTTDNKTNGKVSLDDKPWSKLSNGNNHKHSNGTKNWPKCTNDFKTNSY
IKSNGNNFKDSMKSQTHLGFGGDVKTWNSEKSFVDREAEQDKSNGVKRSFDDEYNEDFGR
GVVKKKKFDSKNHHSKENGSNALQMLHNQFNGKMRRSYIKLIISG
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgttagataaacgtatagaatttgaaatgttagaccataaaccatcaatgttatctcag
atgaaaaacaaaattatcatgttactacaaaatgattgtagtaaaaaagatatgattaaa
aaaaatgaaaggttgaatggtgatactaacaaaatatcccacttacctaatcctaaagta
gtattatatcctcctgaacgtgtacaactaggctggcaagataaaaaaatgtcagttggt
tctggattagataatcctggtgtaatatgttacatcaattctacattacaagcactattt
catatccctgcatttacaaattggcttatgagtgatggacaacatcaaaaaacatgtcaa
aaaaaaactggatttcaaaaagattgtattgtatgtatggtctgtaatacattcaaacta
tctaaaaaactcactggttctagcttcaaagcatcaatcataactaatcgcctttcatta
atatgtaaacatttgtcaacatatcgtcaagaagatgcccatgagttccttcgttatctt
atcgaaagtatggaacagtgctatttgtccgcttttggacctgctgctaaatctctagac
aattattctaaagaaacaacacctattaaccaaatatttggtggttatatgcgcactgaa
gtaatgtgtggtaaatgtggacacatatcaactacatttcaacatttccaagatctcata
cttgatatcagacactctgataatgttaacgacgctttagataactattttaaaaaagaa
ccattagatgaatcatatttatgtgaaatatgtcaacgacaagttgctgctgataaaaag
ttctcaattgaaagagcaccaaacgttttatgcattcagctgaagaggtacagtattggt
atggatggatatagtggaaataaaaatagtaaagctattcaaataaatgaacgattagat
ttatccagttatcaatttgatcatcatacgtttaaaattgatgttcgaccattaagatac
catctggtatctatgataattcattatggttcaagtttacattgtggacattacacaact
cttggtttaacaccctctggatcttattactgtttcaatgattcaaatgtttatcgaaca
aatttcaaaaattattcgacaagtaatgattcctatataatattttatgaattggaacca
tcaggaaacatgaataacacaaatttagaaaggaagacgtctactgtaacatctacttca
acttgtaaaccgtctgtaaatggcttttttccaaacaagagaaatggagttgaaaagcct
ttaaacggtgttacaaaaccattgaacaaaagtagtgataatgagaatagttcactatct
ggtgaagataatgcttctgcgcctgtgatattaggaaaagtcaaacaatcaacagaccaa
agagttcctgataaaaagcctttagttatgagaccaaaggatgatcctagtggagttgct
accgagacacctataaaatgtatagtattgaaaccaccaaaagatgattctcctattaat
gaacgagacaaagaaattctatcagcaaaaaaatgtttagtattgaagcctaaagatgaa
gaaccattggaagtgaaacctgaaccggaacctgtcacaaaatgtttagttagaatttca
aaagatgataacgaatcttctaatactactaaggcatctcattccactgaaggaaaagat
tcagaaaaaaaaaaccgccggcgtgaaaatggaattttgaaattagatgttaataagccc
aaagcccgacctgatcacaattataatggaactaagtcaacaactgataacaaaacaaat
ggaaaagtttctcttgatgataaaccttggagtaaattatcaaatgggaataaccataaa
cattcaaatgggacaaagaactggcccaagtgtaccaatgactttaaaactaatagttat
attaaatcaaatggcaacaattttaaagatagtatgaagtcacaaacacatttgggtttt
ggtggagacgttaaaacgtggaatagtgaaaaaagctttgtagaccgagaggctgaacag
gataaaagtaatggagttaaacgttcatttgatgatgaatacaatgaagattttggtaga
ggggttgtaaaaaagaagaaatttgatagtaagaatcatcactcaaaagaaaatgggtcc
aatgccttgcaaatgttacataatcaatttaatggtaaaatgagacgaagctatattaaa
ctcattatttctggttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system