KEGG   Acyrthosiphon pisum (pea aphid): 100166544Help
Entry
100166544         CDS       T01076                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase-like
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100166544
   00052 Galactose metabolism
    100166544
   00500 Starch and sucrose metabolism
    100166544
   00520 Amino sugar and nucleotide sugar metabolism
    100166544
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     100166544
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 522 aa AA seqDB search
MVEETNVGYSGINIFTNVVKPKGHSPVPSSADLKEFKEVTQRDSLVQLEKEIAALLTTTS
DDKKDLAKSQFAAFSRLFQRFLEESGSSVDWERIEQLPIDSIRDYNTLLKPSPDDIHSKL
EKLVVVKLNGGLGTSMGCRGPKSVIQVRNDLTFLDLTVQQIEHLNKKYNVNVPLVLMNSF
NTDKDTEQIIRKYKGLQVEIYTFNQSCFPRVSKETLLPIAHDCDIEGNIEAWYPPGHGDF
YDSFKNSGLLQKFINSGRDYCFISNIDNLGATVDLNILNMLLDRGTNPLEFVMEVTNKTK
ADVKGGTLIQYENKLRLLEIAQVPKEHLEEFKSVKKFKFFNTNNLWIKLDAIEKVLNEGS
MNLEIIVNNKTLENNLNIIQLETAVGAAMKSFNGGLGINVPRSRFLPVKKTSDLLLVMSN
LYHMKNGSLSMSPLRMFPTTPLVKLGDKDFAKVKDFLSRFATIPDILELDHLTVSGDVTF
GRNVSLKGTVIIIANHGDRIDVPSNATLENKIVSGNLRILDH
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaggaaacgaatgtcggatactcgggaataaatattttcacgaatgtcgttaag
ccaaaaggacactctcctgtaccttcaagtgcagacttgaaggagttcaaagaagttact
cagcgcgattcattggtacaactagaaaaagaaatagccgctttacttacaactacatca
gatgataaaaaagatttggcaaaatctcaatttgcggcgttttcacgtttatttcaacgt
ttcttagaagaatctggctcatcagttgattgggaaaggattgaacaattgcctatagat
tccataagagactataatactttattaaaaccaagtcctgatgatattcattcaaaactt
gaaaaattggtggtggttaagcttaatggaggtcttggtacatcaatggggtgccgaggt
ccaaaatctgttatacaagtcagaaatgatcttaccttccttgatttaacggttcaacaa
attgagcacttaaataaaaaatacaatgtaaatgtaccattggttttgatgaactctttt
aatacggataaagatacagaacaaatcattcggaaatataaaggacttcaagtagagata
tatacatttaaccaaagctgttttcctcgagtatctaaagaaacacttttaccaattgca
catgactgtgatattgaaggcaacattgaagcatggtatcctccaggtcacggagatttt
tatgatagttttaaaaattcaggattattgcaaaagtttatcaacagcggtcgtgattat
tgtttcatctcaaacattgacaacttaggggcaactgttgacctaaatatcctcaatatg
ttattggaccgtggaactaatccccttgaattcgtaatggaagttaccaataaaactaaa
gctgatgtaaaaggtggtactttaattcagtatgagaataaattgagactattggaaata
gcacaagttcctaaagaacatcttgaggaatttaaatcagtaaaaaaatttaagtttttc
aatactaacaacctatggatcaaacttgatgctattgagaaagttctgaacgaaggatct
atgaatttggaaattatagtcaataacaaaacattagaaaataacttaaatatcattcaa
cttgaaacagcagttggtgcagctatgaaatcttttaatggtggtcttggtataaatgta
cctagaagtcgtttcttaccagttaaaaaaacttctgatcttttattggtaatgagcaac
ttgtaccacatgaaaaatggatcattgtcaatgagtccattgagaatgtttcctacaact
ccattagttaaacttggcgataaagattttgccaaagtaaaagactttttgtctcgtttt
gcaactattcctgatatactcgaattggatcatctaacagtttctggtgacgtaacattt
ggtcgaaatgtttctttaaaaggaactgttatcataatcgcaaatcatggagatagaatc
gacgtcccttcaaatgcaacactcgagaacaagatagtatctggaaatctgagaatactt
gatcattaa

DBGET integrated database retrieval system