KEGG   Acyrthosiphon pisum (pea aphid): 100166554Help
Entry
100166554         CDS       T01076                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  
cytochrome c
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Sulfur metabolism
Metabolic pathways
Apoptosis - fly
Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100166554
 Cellular Processes
  Cell growth and death
   04214 Apoptosis - fly
    100166554
   04215 Apoptosis - multiple species
    100166554
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
APHIDBASE: 
UniProt: 
Position
Un
AA seq 104 aa AA seqDB search
MGDEEKGAKVFKTKCAQCHTVEKGGKHKVGPNLNGLIGRKTGDAPGYTYSDANKQKGITW
NDTTLFEYLENPKKYIPGTKMVFAGIKKVDERKDLIAYLKKATK
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacgaagaaaaaggagccaaagtattcaaaacgaaatgcgctcaatgccacacg
gtggagaagggcggcaaacataaagtaggaccaaatttaaatggtttaatcgggcgtaaa
accggtgatgctcccggttatacttatagtgatgcaaataaacaaaagggtatcacatgg
aatgatacaacgttatttgagtacttagaaaaccccaagaaatatatacctggtactaaa
atggtgtttgctggcattaagaaagtagatgaaagaaaagatcttattgcttatttaaaa
aaagctaccaagtaa

DBGET integrated database retrieval system