KEGG   Acyrthosiphon pisum (pea aphid): 100166643Help
Entry
100166643         CDS       T01076                                 

Definition
aldose 1-epimerase-like
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100166643
   00052 Galactose metabolism
    100166643
Enzymes [BR:api01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     100166643
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 468 aa AA seqDB search
MDGSKELSSETMLLNSVSDDAFNDIIYESEEQQKSVYGSDRIIVDNYGCIKDDNGQNVRV
TKYTLMNEQKVVIEIINYGATVISCWVPNSLGELEDVLLGFDSIEDYRLQNTHSIGSTLG
RVTDYISNGHLENDNGEIYELIKNRDGHHFNGGEKGFDKVMWDGYVADDELVLTYSSKDG
EEGYPGTFQARTTFRLTCKNELVVNYIGMTSKSTPVNMASNMFFNLAGQNTGESELMNHS
IMVNADEYVAIKVPGRRPVGLIKNVHNTCLDLRVPRLLKKAFPLVPDSGYNHTFKLFKGK
DRKAFNLAASLVHKQSGRTLDIYTDMPCIYVNTAQDFPNYGKSLFKEEGLTVSNIETPLA
KFDKYENEQESFISEEYNFTSDAELVEEEHNLDHDIKHSPTHVNHVQEIKPIKGKLNTMY
KKHSGICIRPQLFPDAVTHKNFNSIILKPSNIYSQQVIYKFGVIASTD
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggatggttctaaagaactttcttcagagactatgttgttaaattcagttagtgatgat
gcattcaatgatataatttatgaatcagaagaacagcaaaaaagtgtttatggtagtgat
cgcataattgtagacaactatggatgcataaaagatgataatggacaaaatgtcagagtg
acaaaatatactttaatgaatgaacaaaaagttgttattgaaatcattaattatggtgct
accgttatttcctgctgggtaccaaattcactgggtgaactagaagatgtcttacttggt
tttgactcaattgaagactataggttacaaaacacacactctatcggtagtacattaggc
agagtaacagattatattagtaatggtcatctcgaaaacgacaatggtgaaatatatgaa
ctaatcaaaaatcgtgatggtcatcacttcaatggtggtgaaaaaggatttgataaggtc
atgtgggatgggtatgtggcagatgatgaactggttttaacttattcgagtaaagatggt
gaagaaggctatccaggaacatttcaagctcgtacaacatttcgtttgacttgcaaaaat
gaattggttgtaaactatattggtatgacatcaaaatcaactccagtaaatatggcctca
aatatgttcttcaatttagctggacaaaacaccggagagtctgaactcatgaatcattca
attatggtcaatgcagatgaatacgtggcaataaaagtaccagggcgaagacctgttggt
ttgattaagaatgtgcataacacgtgtcttgacttgcgtgttccaagattattaaaaaag
gcttttcctcttgttcctgattctggatacaatcatacattcaaattgttcaaaggaaaa
gaccgaaaagcatttaatttagcagccagcttagtgcataaacaaagtggtcgcacgttg
gatatttacacggatatgccttgtatctatgtaaatactgctcaagattttccaaattat
ggtaaatcattattcaaagaagagggtctgacggtaagcaatatagaaacaccgttagca
aaatttgataaatatgaaaatgaacaagaaagttttatctctgaagaatataactttacg
agtgacgcagaactggtagaagaagaacacaatttagatcatgacatcaaacattctcca
acccacgttaaccatgtccaggaaatcaagcccatcaaaggaaaattaaatactatgtat
aagaagcattctggaatttgcatacgtccacaactatttccagatgctgttacgcataaa
aacttcaacagtattattcttaaaccatcaaatatatatagccagcaagtaatttataaa
tttggagttattgcttcaactgattaa

DBGET integrated database retrieval system