KEGG   Acyrthosiphon pisum (pea aphid): 100166756Help
Entry
100166756         CDS       T01076                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase classes I and II-like
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Phototransduction - fly
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100166756
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100166756
   04070 Phosphatidylinositol signaling system
    100166756
 Organismal Systems
  Sensory system
   04745 Phototransduction - fly
    100166756
Enzymes [BR:api01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100166756
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1201 aa AA seqDB search
MRKLKIEAFLLPQKDSEKTHYHCESGIGLPVTIKVDERGFFLHWMDQKKDCEVIDMSTIR
DTRTGKYARVPKDAKLRSVVCMGSQEPLGDKTITVVVATDFVNVSFINFCCNKKQTAQVW
TDGLLKLALNLVQLNWSPIAFLHKTHTKLSLLVDKNGKIPIKNILKTFAQNKDDRKKVEK
ALESSGLPSNKNDFVSPVKFIFEDFFTFYKNLTARPEVAQLFDDVDHGASGKKKLMTVDQ
FVDFLNRTQRDPRLNEILHPYANSNRAKDLIREFEPNKQNAQRALLSFDGFLKYLMSADN
PIVSSTTFELNNDMDQPLSHYFINSSHNTYLTGHQLTGKSSVEIYRQCLLSGCRCVELDL
WNGKTNEPVILHGYTFVPEVSAREVIEAIAESAFKSSDYPVILSFENHCNTKQQAKIAQY
CHDYFGDMLLCEPLDSHKLEPGFSLPPPSMLKNKIIIKNKKKHHHHHKKPTTSVVLEPAT
AATLVLGNGDIPRGPIRQSSKDSNQDEDEDDDDSSSDTDGEEEDVDRTVDLKHVLQGKPL
VDKVSNTKETEAGTEISVLVNYCQSVQFTSFENAEKKNRHYEMSSFDEKQAMTLLKERPM
EFVKYNKNQLSRVYPAGTRFDSSNFMPQVFWNAGCQLVALNYQTMDVAMQLNLGIFEYNM
RSGYLLKPEFMRRADRTFDPFAESTVDGIIAGTLTVDVISGQLLTDKRVGTYVDIEMYGL
PADTVRKKFRTRTVPYNGINPVYGDEPFVFKKVVLPQLASLRLAVFEESGKLIGHRVIPV
VGLCPGYRHVVLRNEMGQPLPCGTLFLKITVKDYVPDGLSDFAEALANPIKFQSDLDKRT
KQLAVFADELDQSVDEASVAPAERDVKPVTRHQTSCPDLPTGHHMTVTLSAPHRKSVTTN
PVSTMDYLVNDDFSKGPKGSQRNLPVLLSTSLSEGVVAESLSKLNENKLVKDKKMELEKK
LEMLRRKHEKERHRVQHLKSSHDSERMRMSKFSMSSRFVKRLSIKNIQESMLQSNQDASE
SSECDTDNSTSSMPRMSRSQSERLLAIGKEHIVQERDLREKYHEIVFSSLEKVMRSSQSN
QMKMLRVLLDKETAEVMKKLQDRRRHEMKSLAKIHKDKDEIGRIKREVSSSMVEKGVNER
VRLAQIYEKKTEELEKQHEEIRQHFNDLKKKTKAELIKEFEAKIQNVEFGVGPSIKTEFK
Q
NT seq 3606 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaagttgaaaatcgaagcatttttattgccccaaaaagatagtgaaaagacacat
tatcattgtgagagcggaattgggttaccagtgactatcaaagtagacgaacgaggattt
ttcttgcattggatggaccagaaaaaagactgtgaagtgattgacatgtcgacgatacga
gatactaggacaggaaaatacgccagggtcccaaaagacgcgaaattgagaagtgtcgtg
tgtatggggtcccaagagccattgggcgataaaacgattaccgtcgtcgtggccacggat
tttgtgaacgtgtcgttcattaatttctgttgcaataaaaagcaaacagcccaagtatgg
acagatggtcttttgaagcttgctctgaatttggtgcagctaaattggtcaccaatagcg
ttcttgcacaaaacgcataccaaattgagtttattagtagacaagaatggcaaaattcca
ataaaaaatattctcaagacgttcgcgcagaacaaagacgataggaagaaagtcgaaaaa
gccctggagtcatctggattaccgtcgaataaaaatgatttcgttagtccggtaaaattc
atatttgaagatttcttcactttctacaaaaatcttactgctcgacccgaagttgcacaa
ttatttgatgacgttgatcatggagcttcgggtaagaaaaaacttatgacagttgatcag
ttcgtcgatttcttaaatcgtactcaaagagatcctcgtttaaacgaaatactccatcca
tatgccaattcaaatagagcaaaagacctgattcgtgaatttgaacccaacaaacaaaac
gctcaacgagccttgttgagttttgacggttttctcaagtatctgatgagcgccgacaac
cccatagtatcttctactacatttgaattaaataacgacatggatcagccgctatcgcat
tatttcataaattcgtcacataacacttacttgactggtcaccagttgactggtaagtcg
tccgtggagatttacagacagtgcttactgtctggatgtcgatgcgttgaattagatttg
tggaatggaaagacaaatgaaccggtaattctgcacggatacacatttgtacctgaagtg
tcggctcgagaagtaatagaggcaattgccgagtcagctttcaagtcgtccgactaccca
gtaatattgtcatttgaaaaccattgcaacactaaacaacaagcgaaaattgcccaatac
tgtcacgattatttcggcgacatgttgttgtgcgaaccattagacagtcataaacttgag
cccggcttctcgttaccacctccttcaatgctgaaaaacaaaataattataaaaaacaag
aaaaaacatcaccatcatcataaaaagcctacgactagtgtagtgttggagccagctaca
gctgccactttggtgttgggcaatggagatataccacgaggaccaattcgacaatccagc
aaggacagtaatcaagacgaagatgaagatgatgatgacagcagtagcgataccgatgga
gaagaagaggacgtagatagaacggttgatttaaaacatgttttacaaggtaagcctttg
gtcgacaaggtatccaacaccaaagagactgaagctggtacggaaatttcggttctcgta
aattattgtcaatcagtgcaattcacctcctttgaaaatgcagaaaaaaaaaaccggcac
tatgagatgtcatcgtttgacgagaaacaagcaatgacattgctgaaagaacgaccaatg
gagtttgtcaagtataacaaaaatcaattgagccgagtttatccagccggtacacgtttt
gactcgtccaactttatgccacaagtgttttggaatgcaggatgtcagcttgtcgcattg
aattatcaaaccatggacgtggccatgcagctaaatttagggatatttgagtacaacatg
cgcagcggttatttgttgaaaccggagttcatgaggcgcgccgaccgtacgtttgacccg
tttgccgaatctaccgtggacggaatcattgctggtacactaaccgtcgacgtcatatcc
ggtcaactgcttaccgataagcgcgtcggcacttacgtggacatcgagatgtatggcttg
cccgcggatacggtcaggaaaaaatttcgtactcggactgtaccgtacaatggcattaac
ccggtgtacggtgacgaaccttttgtgttcaaaaaagtggtccttcctcaactcgcgtct
ctacgtctagccgttttcgaggagtccggaaagttgatcggccatcgtgtcattccagta
gttggcctctgcccgggatatagacacgtcgtattgcgtaacgaaatgggtcagcccctg
ccttgcggaacgttgttcttaaaaatcacagtaaaagactacgtcccggacggcttatca
gattttgccgaggctttggctaatcccataaaattccaatccgatctggataaacgcacc
aagcaattagctgtcttcgcggatgaactggaccaatccgttgacgaagcgagtgtcgca
ccggcggaacgagatgtaaaaccagtcacccgtcatcagaccagctgcccagacttgccc
accggccaccacatgaccgttacattgtcggcaccgcaccggaaatccgtgactactaat
cccgtgtcgacgatggactatttggtcaatgatgacttcagcaagggtccgaaaggctcc
caaaggaatcttccggtgctgttgtctacttctctgagcgaaggtgtagtcgccgaatct
ctttcaaagcttaacgaaaacaagctggtaaaggataagaaaatggagctggagaaaaag
ctcgaaatgcttcggaggaaacacgaaaaagagagacaccgcgtgcagcacctgaaatcg
tcgcacgattcggaacggatgcgaatgtccaagttctcgatgagttcccgattcgtcaag
cgactatcgataaagaatatccaggagagtatgttgcagagtaaccaagacgcgtccgaa
tcctcagaatgcgacacggataattccaccagttcaatgccgaggatgtccagaagccag
tccgaacggttactggccatcggcaaagagcacatagtacaggaacgggacctccgtgaa
aaatatcacgagatcgtgttttcgtcgttggagaaagtgatgcgttcgtcgcaatcgaac
cagatgaaaatgttgcgcgttctgttggataaagaaaccgcagaagtgatgaaaaagttg
caggaccgtcggcgacatgaaatgaaatcgttggcaaaaatacacaaggacaaggacgag
attggaaggatcaagcgagaagtatccagttcgatggtggaaaagggtgtgaatgaacgg
gtgcgcttggctcagatctacgagaagaaaactgaggagctagaaaaacagcacgaagaa
attagacagcattttaatgatctcaaaaaaaaaacaaaagcggaattgatcaaagaattc
gaggccaaaatacaaaatgttgaattcggagttgggccgagtattaagaccgaattcaaa
caatga

  All links  
No link information was found.   
DBGET integrated database retrieval system