KEGG   Acyrthosiphon pisum (pea aphid): 100166899Help
Entry
100166899         CDS       T01076                                 

Definition
ubiquitin carboxyl-terminal hydrolase 34-like
Orthology
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.4.19.12]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100166899
Peptidases [BR:api01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100166899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1949 aa AA seqDB search
MCECETCIEFSKLLKPYRDASAKNDFSCVILSKSEVNQLVVFVQAFMQRQCLGGFQDRKN
YEQFQWITQCFVLLMTNLLKSYKGQDNIIYPARDDDDAESSRKWENLLANFKDEELQWTL
AEMEKPLHLMTKVFLMNFPLYVAVKQYPHYKTEEVTQQEVSAMNHYCDVQEIDMPLLLLR
TVNMFCRVGGLEAIMSCFDYESLPLTIANPIVILACNVKLWLNYHTNVHVFVPLRSKVLR
FMCNLSDKELRTPAAKTMADFMWSSNKDGHTSNLDKDGLELAFKYFTSPTLTMRLAGISQ
INSHIGSLNELVHVTAATLSTSSQSNDMVTIEQIGHNLATWLVHRKIISHVFGPNLHVEV
IKQCSITLNFLASEGKITNEHIDTIWQAAQLKHCSKQVFDLLPGFIKHLEPAPVLHLYHL
LRKLEPKEHTEQSLFLASALTKFIWSSMATTARTHEFSIPKMSRIISIRDGRRITRSNDM
STSENSASLNSNSEGESSDERSDMSDGPTPRKKPKKENIFTYSDNESLVLEGAKIEELDE
DFDINEKDIIRPSKPLGMCKIRHCVRKKAMRDTRMRVMKPCNSSDEDSDKVQINHCKLVK
GTKLQKPRGKINNHKKIRNLKMRCIRTDCTEDDSESDGDEDDDEEDEDEDEDIEDEDSES
MEAMEIGISPIDTTSDQQVPSTLINRQMLEDYSGDENSMSSRMSNKSDKNMADFDGEDSG
CDEELLQLAARAQTHLSTQQLNHMAFHSNFHTSKNVHPCTQNITTTISNQFNIENVCKPG
STLLWDLLQDDNITLLGESLALEAEKALFNLVCFNTDRAIRMKFIEGCLENIQKNKSVVI
SLRLLPKLFASFHQFRGASLANLNVGMDTRQVTLWAVKHHSMIDRVFNNFREYCKQHADN
LFEDSGFYSHQIHIEARLQFLTHIYSSIGLPDTIKLTIDELDTLWNCLVSDEVCRDELFN
WLLRQVRCREQHTFNVETLTHLYCEKLLSLAPESYTMTALSLFTQLCNMAQQQVSSDYLL
LARNGHAAAMEHLSRIALKALNNDVSIAAIQYINNYYMMNLQLDKEDKFISECVSNLSVA
ADTLNDKEESSLLYIQRALLLLKTHLETFKRKYAYHLRKWTLEGHGIMSHVIQNDKNAAT
IRLNINPAMLDEKLTLDMPSTDYIADMRAEIAHWWESQNDNLTIQKLPTDGNIRMIALGQ
EITSDFDEKTIQETGLKDNQIIYLSLSTTRKKKLGDQDLPGSVQFVPTKESSPTLLLLRP
KNFEVLFGLMHTLGSMKTVDEEENELLHGRAQVLSRSVWDILTILPTSPSMLECFKHFPT
HESKDKCQVWLKKDLDPSNLQKLMYSLYIVESLVQVGVEKNSDEDEVLTEVSTNGLSSSW
GEYFIEKGGLEHLFTILLSGTLQGNSEWHQDCLAHLLKLLCQLGVSPNDRRQLDQFEGLG
FDPYFRPRKSHIKKQANLVVPKLNKEMLKLMKIDLVIPRLMSILNELSYPGHPKDIKTGF
WGRAQVIHFLMTLVLSWSHSVNGICEALLESNQFSMWLCNLVLEDPDPLVRHEICVALYR
LCAVPPANRTAATLLLSQLIKFLDKAECMQPQNIRHENSMRITDEDKLNYGPACRDYFWL
MCRLVNCLPNDIIQESIKFPPKCIIDIEALAIRVWESIASRDFIETHYSGLQDDGLIGLL
NLMSNILGHKPPFKFSKRSHNVLDTVFEFLFALPDPQNRQLPKCKSESARSSAYDLLVEL
VKETPQNYEYLYKKLLEQHSNDLNRLPYLWDYWPHDDGRSNCGYVGLTNLGATCYMASCM
QHLFMMPQARRSILEAKCDESNKHASILVELKRMFAYLLESERKTYNPRSFCKVYTMDQQ
LLNTGEQKDMAEFFIDLVSKLEEMTPELKTLVKTLFGGVISNNVVSLFELARMSQFPKFK
LRGAKKMTTMQTMIATNQRTSGGSQMSLR
NT seq 5850 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaatgtgagacatgtatagagttttcaaagctactgaaaccatatagagatgca
agtgcaaagaacgactttagttgtgtaattctatccaagtctgaagtgaatcaattggtt
gtttttgttcaggcttttatgcaaagacaatgtcttggtggatttcaagatagaaaaaac
tatgaacagtttcagtggattacacaatgttttgttttgttaatgactaatttgttaaaa
tcttataaaggacaagataatattatctatcctgctcgtgacgatgatgatgctgagagt
agccgtaaatgggaaaatttactagcaaatttcaaagacgaagagttgcaatggacatta
gcagaaatggaaaaaccgttacatctcatgacaaaagtatttttgatgaattttccatta
tatgtggctgtaaaacaatacccacattacaagacagaagaagtaactcaacaagaagtt
tcagcaatgaatcattattgcgatgttcaagaaatcgatatgccattattacttctaaga
actgtcaatatgttttgccgggttggtggtttggaagcaattatgtcttgttttgattat
gaatcattgccattaactattgcgaatccaattgttatacttgcttgtaatgtaaaactg
tggctaaattatcacacaaatgttcatgtatttgttccactgaggtcaaaagttttaaga
tttatgtgtaacttatctgataaagaattgagaactcctgcagctaaaactatggctgat
tttatgtggagttcaaacaaggatggtcatacttctaatttagataaagatggtcttgaa
ttggctttcaagtattttacatccccaacattaacaatgaggctagcaggaatatctcaa
attaatagccatataggatctttaaatgaacttgttcatgtaacggcagcaacattatca
acatcatcacaatccaatgatatggttactatcgaacaaattggacataatttagcaact
tggcttgtacatcgtaaaattatatcccatgtgtttggcccaaatttacatgttgaagta
attaaacagtgtagtattacacttaattttttagcatcagaaggtaagattactaatgaa
catattgatactatttggcaagcagcacagttaaaacattgtagcaaacaagtttttgat
ttattacctggttttatcaaacacttagagcccgctcctgttttacatttatatcattta
ctaagaaaactagaaccaaaagagcacactgaacaaagcttatttttagcatcagctctt
accaaatttatttggtcaagtatggcaactactgcacgaactcatgaattctctattcca
aaaatgtcaaggattataagtatacgtgatggccgtagaataactcgttcaaatgatatg
agtacatcagaaaatagtgctagcctcaatagcaattccgagggtgaatctagtgatgaa
cgaagtgatatgagtgatggtccgactcctagaaaaaaacctaaaaaagaaaacattttt
acttactctgataatgaatcattagttctagaaggagcaaaaattgaagaattagatgaa
gattttgatattaatgaaaaagatattattagaccatctaaaccattaggtatgtgcaaa
ataaggcattgtgttagaaagaaagcaatgagagatacgagaatgagagtgatgaaacca
tgtaactctagtgatgaagattcagataaagttcaaataaatcattgtaagctagtaaag
ggaaccaaacttcaaaaaccaagaggaaaaatcaataaccacaaaaaaatacgaaatctt
aaaatgaggtgcattagaactgattgtaccgaagatgattctgaatctgatggtgatgaa
gatgatgacgaggaagatgaggatgaggatgaggatattgaagatgaagatagtgaatca
atggaagcaatggaaattggtatatcacccattgatactacttcagatcagcaggtacca
tctacactcattaatagacaaatgctagaagactatagtggagatgagaatagtatgtca
tctcgtatgtcaaataaatctgacaaaaatatggctgattttgatggagaagattcaggc
tgtgatgaggaattgttgcaacttgcagcacgtgctcagactcatttatcaacacaacag
ttaaaccatatggcattccattctaatttccataccagtaaaaatgtgcatccttgtact
caaaatataactacaacaatatctaaccagttcaatatagaaaatgtttgtaaacctggt
tcgacattattgtgggatttacttcaggatgataatattacgctcctcggtgaatcatta
gctttagaagcagaaaaagcattgtttaatttggtgtgctttaatactgatcgtgctatc
agaatgaaattcattgaaggctgtttagagaatatacaaaaaaataaatctgtagttatt
tcattaagattattacctaagttatttgcatcatttcatcaattccgaggagcttcattg
gctaatcttaatgttggaatggatactcgtcaggtgactctttgggctgttaaacaccac
agtatgattgatagagtatttaacaattttcgagagtactgtaaacaacatgccgataac
ttgtttgaagattcaggattttactctcaccaaatccatatagaagctaggttacaattt
ttgactcatatttactcttcaattggacttccagatactattaagttaaccattgatgaa
ctggatacattatggaattgtttggtatctgatgaagtttgtcgggatgaattatttaat
tggttattacgacaagtccgttgtcgtgaacaacatacatttaatgttgaaacattgaca
catttatactgtgaaaaattgttatcattagctccagaaagttatactatgactgctctt
agtttatttacacagctatgtaatatggcccaacaacaagtatctagtgattatttgttg
ctagcaagaaatggccatgcagctgctatggaacacttatcaagaattgcattaaaagca
ttaaataatgatgtaagcattgctgctatacaatatataaacaactattatatgatgaat
ctacaacttgataaagaagataagtttattagtgagtgtgtatcaaatttgtctgtagct
gcagatactttgaatgataaagaagaatccagtcttctttacatacaacgagctctgtta
ctattaaaaactcacttagaaacatttaagagaaagtatgcttatcatttaagaaaatgg
actttagaagggcatggtattatgagtcatgtaattcaaaatgataaaaatgcagcaaca
attagattaaatatcaatcctgccatgttagatgaaaagttaactcttgatatgcctagt
acagattatatagctgatatgagagctgaaatagctcattggtgggaaagtcaaaatgat
aatttaactattcaaaaattacctacagatggtaatatacgcatgattgcattaggccaa
gaaataacatcagattttgatgaaaaaactattcaagaaactggattaaaagataaccaa
attatatacttatcattaagtactactcgtaagaagaaacttggggaccaagatttacca
gggtctgtacaatttgtaccaaccaaagagagttctccaacattattgcttttacgacct
aaaaactttgaagtactgtttggtcttatgcatactcttggatcaatgaaaacagttgac
gaagaagaaaatgaattactacacggaagagctcaagtattatcaagaagtgtttgggat
attttgactatacttccaactagtccctcaatgttagaatgttttaaacactttccaaca
catgaatcaaaagacaaatgtcaagtttggttaaagaaagatttagatccatcaaattta
caaaaattaatgtattcattatacatagtcgaatcattagttcaggtgggagttgaaaaa
aattcagatgaagatgaagtattgacagaggtatcaacaaatggattatctagttcatgg
ggagaatatttcattgaaaagggaggtttagaacatctctttactattttgttgtctggt
acgcttcagggtaacagtgaatggcatcaagattgcttggctcatttacttaaattactg
tgtcaacttggtgtgtcaccaaatgatagacgacaattagatcaatttgaaggactaggg
tttgatccttattttcgaccaagaaaatcacacattaaaaagcaagctaatctggttgtg
ccaaaacttaacaaagaaatgttaaaacttatgaagatagatttggttatacctagattg
atgagtattttaaatgagttatcttatcctggacacccaaaagatataaaaaccggtttt
tggggccgagctcaagttattcatttcttaatgactttggttttgtcatggtctcacagt
gtaaatggtatttgcgaagcacttttagaatctaaccagttctccatgtggctttgcaat
cttgttcttgaagatccagatccattagttagacatgaaatatgtgttgcattatatcga
ctttgtgctgtaccccctgcaaatcgtaccgctgctacattactattatctcagttaatc
aagttcctagataaggctgaatgcatgcaaccacaaaatataagacatgaaaattcaatg
agaataactgatgaagataaacttaattatggaccagcttgccgagattatttttggctt
atgtgtcgacttgttaattgcttaccaaatgacatcattcaagaaagtattaaatttcca
ccaaaatgtattattgatattgaagcattggctatacgtgtttgggaatcaattgcatct
agagattttattgagacacattatagtggccttcaagatgatggtttgattgggctctta
aatttaatgtcaaatatactagggcataaacccccttttaaattcagtaaacggagtcat
aacgttttggacacggtttttgagtttttgtttgctttacccgatcctcagaatcgacag
ttacccaaatgtaaatctgaaagtgctcgatcttcagcttatgatttattagttgaatta
gtaaaagaaactcctcaaaactatgaatatttatacaaaaaattattagagcaacacagt
aatgatttaaatcggcttccatatttatgggattattggcctcatgatgatggtcgatct
aattgtgggtacgttggcttaacgaatcttggtgccacttgttatatggcctcctgtatg
cagcatttatttatgatgccacaagcaagacggtccatacttgaagcaaaatgtgatgag
tctaataaacatgcatccatactggttgagcttaagcgaatgttcgcttatttattggaa
agtgaaagaaaaacttacaatcctcgtagcttctgcaaagtttatacaatggatcaacaa
cttttgaatactggtgagcagaaagatatggctgaattttttattgaccttgtatctaag
cttgaagaaatgacaccggaattaaaaacacttgttaagactctatttggaggtgtaatt
agcaacaatgttgtttcattgttcgagttagcacgcatgtctcagttccctaaattcaag
ctgcgtggcgcaaaaaaaatgacaaccatgcaaacaatgatcgcaaccaatcagagaaca
tctggtggtagccagatgtccctaagataa

DBGET integrated database retrieval system