KEGG   Acyrthosiphon pisum (pea aphid): 100166969Help
Entry
100166969         CDS       T01076                                 

Definition
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1-like
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100166969
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    100166969
Enzymes [BR:api01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100166969
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 875 aa AA seqDB search
MACGSLTPNVFISELDQIMNILERGTIVTRFYLKKRPEKRTLKLRKETRQILWSRTSSSN
NKTFDGSLDLKDAKEVRCGRNSKEFDRWPDELKKFEASKCFVIFYGNEFKLKTLSIVALS
EQECELWIKGLYHLVNDTVCAPYPLQVERWLRKEFYIMENSRETVTLKDVKSFFPRVHCK
ISTSKLRELFQEVDTRKRNELNFDEFVTLYNKLIYNSGIFNECFSMYCSADDTFNVQNLT
RFLNAEQESLCLEEEVVAKHMKEYFKYCGRDLNDKLQFTSTDFMDYLFSKQNEIWDQYYD
NIFQNMTKPLSHYWIASSHNTYLTGDQVSSESSIEAYVRCLRWGCRCIELDCWDGPDGLP
IIYHGHTLTSRIKFLDVLKTIKEHAFIASPYPVILSIEDNCSIPQQRNMASTMIEVLGDM
LLTQPVDRNENKMPSPEQLMYKFIIKHKRLPEKVNGDQAVTVRHNDDSKDTDLRNTKKNG
VLYLEDPLEKEWRPHFFVLSGNKLYYTDLCKSDIDNEDEADGGELEISDVSSANRLREGI
PNDELHFGEYWFHGKLARGRNEAEELLKQYQHFGAGTFLVRQSDTFIGDYSLSFWHLGKV
NHCRIRSKHDRGQIKYYLIDGAAFDSLYSLITYYRTYPLRIQGIPNDELHFGEYWFHGKL
ARGRNEAEELLKQYQHFGAGTFLVRQSDTFIGDYSLSFWHLGKVNHCRIRSKHDRGQIKY
YLIDGAAFDSLYSLITYYRTYPLRIQECYIILNEPVPQPLKHEGMSWYLPHVCRSRAEAL
LRRVPQEGAFLVRPCENDKHLYAISFRAEKKIKHCRIKLEGRLYTIGVKQFESLVELIKY
YEQNYLYKKIKLWYPVNEDIVQRMGTVCYKIIILK
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atggcttgcggctcattaacacctaatgtgttcatctcagaacttgatcagattatgaac
atcttggaacgaggcacaatcgtcactcgattttatttgaagaagcggcctgagaaacga
acattgaagttacgcaaggaaacacgacagattctctggtcaaggacaagcagtagcaac
aataaaacctttgatggctctttggacctcaaagatgccaaagaagtacgttgtggtaga
aatagtaaagaatttgatagatggcctgatgaattgaagaaatttgaagcgtccaaatgc
tttgtcatattttatggcaacgaattcaaattgaaaactctttccatagttgcattatcc
gaacaagaatgtgaactatggatcaaaggcttatatcatcttgtaaatgatactgtctgt
gctccatatccattgcaagttgaaagatggctgcgtaaagaattttatattatggaaaat
tcaagggaaacagtgacattgaaagatgtaaaatctttttttcctcgtgttcattgcaaa
atttcaaccagtaaactacgagagttgtttcaagaagtcgataccaggaagcgtaatgag
cttaattttgatgagtttgtcactctctataataagcttatctataattcagggattttc
aatgaatgtttttcaatgtattgttcagccgacgacacattcaacgttcaaaatctaact
aggtttctgaacgctgaacaagaaagtttatgtcttgaagaagaagttgttgctaaacac
atgaaagaatatttcaagtattgtggaagagatttaaatgataagctacaatttacctca
actgattttatggattatttgttttcaaaacaaaatgagatatgggatcaatattacgac
aatatatttcagaacatgacaaaaccactttcacattattggatagcatcttctcataat
acctatttaactggcgatcaagtatctagtgaaagttcaattgaggcatatgtaaggtgt
ttacgctggggatgtcgctgtatagaattagattgttgggatggaccagacggactacca
ataatataccacgggcatacattaaccagtcgtataaaatttttagatgtccttaaaacg
attaaagaacatgcttttattgcttcgccgtatccagttattttgtcaatagaagacaac
tgttcaataccacaacagcgaaatatggcatcaactatgattgaagtattaggagatatg
ttacttacacaaccagttgaccggaatgaaaataaaatgccttcccctgaacaacttatg
tataagttcataataaaacataaaagacttccagaaaaagttaacggagaccaagctgtc
acagtcagacataacgatgattctaaggacactgatttaagaaacacaaaaaaaaatgga
gtactttatctagaagatccgttggaaaaagaatggagacctcattttttcgtactgtct
ggtaataagctttattatacagacctctgtaaatcagatatcgataatgaagatgaagca
gatggaggagagttggaaattagtgatgtatctagtgcaaatcgattgagagaaggtata
cctaatgatgaattacattttggagaatactggtttcatggaaaattagctcgtggtaga
aatgaagctgaagaactattgaaacagtatcagcattttggagccggtacatttttagta
agacaaagtgatacattcattggcgattattccctatcattctggcatctaggtaaagta
aaccactgcagaatacgctcaaagcacgatagaggtcaaataaagtattatttgatagat
ggtgctgcatttgacagtttatatagtttgataacttattatcgtacatatccattacgt
atacaaggtatacctaatgatgaattacattttggagaatactggtttcatggaaaatta
gctcgtggtagaaatgaagctgaagaactattgaaacagtatcagcattttggagccggt
acatttttagtaagacaaagtgatacattcattggcgattattccctatcattctggcat
ctaggtaaagtaaaccactgcagaatacgttcaaagcatgatagaggtcaaataaagtat
tatttgatagatggtgctgcatttgacagtttatatagtttgataacttattatcgtaca
tatccattacgtatacaagaatgctatattattttgaatgaacctgtacctcagccttta
aagcatgaagggatgagttggtatcttcctcatgtttgtagaagtcgagcagaggcatta
ttgcgacgagtaccacaagaaggtgcatttttggtgcgaccatgtgaaaatgacaaacat
ctttatgctatttcatttagagctgaaaagaagattaaacactgtcgcattaaacttgaa
gggcgattgtacactattggtgtaaaacagtttgaaagcctagtggaacttataaagtat
tatgaacaaaattatttatataaaaaaattaaactatggtatcctgtaaatgaagatatt
gtacaaagaatgggaactgtttgttataagattataattttaaaatga

DBGET integrated database retrieval system