KEGG   Acyrthosiphon pisum (pea aphid): 100166978Help
Entry
100166978         CDS       T01076                                 

Definition
mitogen-activated protein kinase kinase kinase kinase 3-like
Orthology
K08842  
testis-specific kinase 2 [EC:2.7.12.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100166978
Protein kinases [BR:api01001]
 Serine/threonine protein kinases: TKL group
  LISK family [OT]
   100166978
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 572 aa AA seqDB search
MTNYVNTMEEKSEFQRKEGCRLKGNSCCALKHAVRSLTNLDDFVSERIGEGFFSEVYRVT
HRNTGKVMVLKMNIKQSNRFNMLKEVQLMNKLSHPNILGFEGACVYKGQLHALTEYINGG
SLEQLIESDIDLSFKVRMKISLDIARGMKYLHSRDIFHRDLTSKNVLIKKNESTEDLTAV
VADFGLAAKIPKKGQRLQQVGSPWWMSPECVKGNVYNESSDVFSYGIVLCEIIARVKADP
DILPRTQNFGLDYIAFVELCSSCPPPTMFLKLAFSCCHLDAKSRPTFNEIVQQLEEAIAF
PLTVNSNLSGSRRCPVVTTRSNPCSTAMVEARSEEFLLQNNGPEENSHKKLCHSRSLSED
EGILAFPAHTAPSDKARCHFVQPLRYVGESMCRQDPHYKPCPSKSNPFHKLDAKFQGVQK
ILASTNGSDLFSSCCELPSPGYVELDRRCSLSVSSGGTLIADSSIPKGKHRNIDKSSKKC
RSTSLPSSPLMSRTNGRRWMSLTNIDNTAKTFPTVTVDSCWTDLTIPVNSGVANLRRRGS
CESGFYSSVCDDFCLPANESEININDRHFGRT
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgacaaattacgtgaatactatggaagagaagtctgagttccaacgtaaagaaggatgt
cgattaaaaggcaactcttgttgtgctcttaagcatgcagtgcgttcacttacaaatcta
gatgattttgtcagtgagcgtattggtgaaggtttcttctctgaagtataccgtgttact
caccgaaacactggaaaagtaatggtactcaaaatgaatatcaaacaatcaaatcggttc
aatatgcttaaagaagtgcagcttatgaacaagctttcacatcctaacatacttggattt
gaaggtgcttgtgtatataaaggacaactccatgcattaactgagtatatcaatggtgga
agtttggaacaattaattgagtctgatattgatctttcatttaaagtaagaatgaaaata
agtctagatattgcaaggggcatgaagtatcttcattcaagagacatatttcatcgtgat
ttaacttcaaaaaatgttttaattaaaaaaaatgaatcaactgaagatctgactgctgtt
gtggccgattttggtctagctgcaaaaataccaaagaaaggacaaaggttacagcaagtt
ggttcaccttggtggatgtcaccagaatgtgttaaaggcaatgtatataatgaaagcagt
gatgtttttagttatggaattgtgttatgtgaaattattgccagagtgaaagcagatcca
gatattttacctagaacccaaaattttggtctggattatatagcttttgttgagttatgt
tcatcttgtcctccaccaactatgtttctcaaattagcattttcttgttgccatttggat
gctaaatcacgtccaacatttaatgaaatagttcaacaactagaagaagcaattgctttc
ccacttacagtaaattcaaatttatctggatcacggagatgtccagttgttacaactcgg
tcaaatccttgctcaacagcgatggtggaagcacgaagtgaagagttcctgctacagaat
aatggacctgaagaaaatagtcataaaaaattgtgtcacagtagatcattgtcagaagat
gaaggtatattggcttttccagcacatacggctccatcagacaaagcacgatgtcatttt
gttcaacctctacgttatgtgggtgaaagtatgtgtcgtcaagatccacattataagcct
tgcccgtccaaatccaatccttttcataaattggatgcaaagtttcaaggcgttcaaaag
atacttgcttcaacaaatggttcagatttattttcatcatgttgtgaactaccatcacct
ggttatgtggagcttgataggcggtgttctttaagtgtgtcaagtggtggtacacttatt
gcggactcatctatacctaaaggaaaacatagaaacattgataagtcttcaaaaaaatgt
cgctctacatctttgccatcatctccactaatgtctagaactaatggaagacggtggatg
tcattaacaaatattgataatactgctaaaacatttcctactgtaacagttgattcgtgt
tggaccgatctcacaattcctgtcaactctggtgtagctaatctaagacggagaggctca
tgcgaatctggtttttacagtagtgtttgtgatgatttttgtttaccagcaaacgaaagc
gagatcaatattaatgaccgacattttggcaggacttga

  All links  
No link information was found.   
DBGET integrated database retrieval system