KEGG   Acyrthosiphon pisum (pea aphid): 100166978Help
Entry
100166978         CDS       T01076                                 

Definition
(RefSeq) probable serine/threonine-protein kinase DDB_G0278665
Organism
api  Acyrthosiphon pisum (pea aphid)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
APHIDBASE: 
Position
Un
AA seq 696 aa AA seqDB search
MCYQNVMTNYVNTMEEKSEFQRKEGCRLKGNSCCALKHAVRSLTNLDDFVSERIGEGFFS
EVYRVTHRNTGKVMVLKMNIKQSNRFNMLKEVQLMNKLSHPNILGFEGACVYKGQLHALT
EYINGGSLEQLIESDIDLSFKVRMKISLDIARGMKYLHSRDIFHRDLTSKNVLIKKNEST
EDLTAVVADFGLAAKIPKKGQRLQQVGSPWWMSPECVKGNVYNESSDVFSYGIVLCEIIA
RVKADPDILPRTQNFGLDYIAFVELCSSCPPPTMFLKLAFSCCHLDAKSRPTFNEIVQQL
EEAIAFPLTVNSNLSGSRRCPVVTTRSNPCSTAMVEARSEEFLLQNNGPEENSHKKLCHS
RSLSEDEGILAFPAHTAPSDKARCHFVQPLRYVGESMCRQDPHYKPCPSKSNPFHKLDAK
FQGVQKILASTNGSDLFSSCCELPSPGYVELDRRCSLSVSSGGTLIADSSIPKGKHRNID
KSSKKCRSTSLPSSPLMSRTNGRRWMSLTNIDNTAKTFPTVTVDSCWTDLTIPVNSGVAN
LRRRGSCESGFYSSVCDDFCLPGLECQHATNASSVTLSSGSATSSLFLDSTGDEHHLRPG
GYCFLHNNTHHSSDDLSTCNEWENHQKTRHISKIVEYFEEKQSQRETQPSIRPRRSGLVS
GVLRRATNTTSPNVCGKRILVCEGAVRSKLKLFDRK
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgtgttatcaaaatgttatgacaaattacgtgaatactatggaagagaagtctgagttc
caacgtaaagaaggatgtcgattaaaaggcaactcttgttgtgctcttaagcatgcagtg
cgttcacttacaaatctagatgattttgtcagtgagcgtattggtgaaggtttcttctct
gaagtataccgtgttactcaccgaaacactggaaaagtaatggtactcaaaatgaatatc
aaacaatcaaatcggttcaatatgcttaaagaagtgcagcttatgaacaagctttcacat
cctaacatacttggatttgaaggtgcttgtgtatataaaggacaactccatgcattaact
gagtatatcaatggtggaagtttggaacaattaattgagtctgatattgatctttcattt
aaagtaagaatgaaaataagtctagatattgcaaggggcatgaagtatcttcattcaaga
gacatatttcatcgtgatttaacttcaaaaaatgttttaattaaaaaaaatgaatcaact
gaagatctgactgctgttgtggccgattttggtctagctgcaaaaataccaaagaaagga
caaaggttacagcaagttggttcaccttggtggatgtcaccagaatgtgttaaaggcaat
gtatataatgaaagcagtgatgtttttagttatggaattgtgttatgtgaaattattgcc
agagtgaaagcagatccagatattttacctagaacccaaaattttggtctggattatata
gcttttgttgagttatgttcatcttgtcctccaccaactatgtttctcaaattagcattt
tcttgttgccatttggatgctaaatcacgtccaacatttaatgaaatagttcaacaacta
gaagaagcaattgctttcccacttacagtaaattcaaatttatctggatcacggagatgt
ccagttgttacaactcggtcaaatccttgctcaacagcgatggtggaagcacgaagtgaa
gagttcctgctacagaataatggacctgaagaaaatagtcataaaaaattgtgtcacagt
agatcattgtcagaagatgaaggtatattggcttttccagcacatacggctccatcagac
aaagcacgatgtcattttgttcaacctctacgttatgtgggtgaaagtatgtgtcgtcaa
gatccacattataagccttgcccgtccaaatccaatccttttcataaattggatgcaaag
tttcaaggcgttcaaaagatacttgcttcaacaaatggttcagatttattttcatcatgt
tgtgaactaccatcacctggttatgtggagcttgataggcggtgttctttaagtgtgtca
agtggtggtacacttattgcggactcatctatacctaaaggaaaacatagaaacattgat
aagtcttcaaaaaaatgtcgctctacatctttgccatcatctccactaatgtctagaact
aatggaagacggtggatgtcattaacaaatattgataatactgctaaaacatttcctact
gtaacagttgattcgtgttggaccgatctcacaattcctgtcaactctggtgtagctaat
ctaagacggagaggctcatgcgaatctggtttttacagtagtgtttgtgatgatttttgt
ttaccaggacttgagtgccagcatgcaactaatgcttcatcagtgactttgtcatctggt
tcagctacatcatcattgttccttgactccactggtgatgaacaccatcttagacctggc
gggtattgttttctacacaataacacacatcatagttcagatgacctatcaacatgtaat
gaatgggaaaaccatcaaaagactagacatataagtaaaattgttgagtattttgaagaa
aaacagagtcaacgggagacacaaccctccatacgaccaaggcgttcaggtcttgtatct
ggagttttacgacgtgcaacaaacacaactagtccaaatgtatgtggcaaacgtattttg
gtttgtgaaggagctgtaaggtcaaaactaaagctttttgatagaaaataa

DBGET integrated database retrieval system