KEGG   Acyrthosiphon pisum (pea aphid): 100167076Help
Entry
100167076         CDS       T01076                                 

Definition
alkaline phosphatase-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100167076
Enzymes [BR:api01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100167076
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100167076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 542 aa AA seqDB search
MMMGRHQLELLVVTLALINCRVAAIEDEAYWMSVGREELNNALNVEVNNKVAKNVILFIG
DGMGPNTVTATRIYKYKESGRLTFEKFPHVGLLKTYSVDKQVPDAASAATAMFTGVKVNQ
RTIGLDANYQINDITHCDNTDSRRIGLTSLATWAQDAGKSTGFVTNTRITDATPAALYAR
TSNRKWECNAAMPPSAKNCKDIARQLIEDRPGRHFKVIMGGGKKSFEANSPPNPKEPVDK
SLCVRSDRKDLIRAWIDDKLSNNLSHKFLTNVNDIKLLDTEGTEYILGLFTNGTMPMEYT
RNKTSLRIPSLELMTETAIKVISKNENGFFLMVESGLIDAAHHQSTARLALDETVEFDKT
INTSINLLKQLNMLHDTLVIVTSDHANLLSINGYPNRGNNILAVAGISESDDVPYTTLTY
SIGYAKRPVYTRQGVLVIRQNPTASVNTTIHDYSQQVGIPEETGLHGGSDVAVYAKGPMG
HLFHSIHEQNYIAHAIAYATKIGAYQCEQSMNQSYIHFSSIYLICTLILSLLYFNEVTVL
RF
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgggtcgtcatcagctggagcttttggtggtgacgctcgccctgattaactgc
cgggtggcagccatcgaagatgaagcgtattggatgtcggtgggcagagaagagctgaac
aacgctctaaacgtggaggtcaacaacaaggtagcaaaaaacgtgatcctgtttatcggc
gacgggatgggaccgaacacggtaacggccaccagaatttacaagtacaaggagagcgga
cgattgacttttgaaaagtttccacacgtgggcttgcttaaaacgtattcggtcgacaaa
caagtgccggatgcagcgagtgcagcaactgcaatgttcacgggtgtaaaggtcaatcag
aggactattggcctggacgcgaattaccagatcaatgatataactcactgtgacaatacc
gattcgcggaggatcggccttacgtcgttggccacgtgggcgcaagatgctggaaaaagc
accgggtttgtgaccaacaccaggattaccgatgctacgcccgccgccctatatgcccgg
acgtcgaaccggaagtgggaatgcaacgccgctatgccgccaagcgcgaaaaactgcaag
gacattgccaggcagctcattgaagaccgaccaggacgacattttaaggttataatgggc
ggcggcaagaaatcgtttgaagctaattcaccaccgaacccaaaggaacccgttgataaa
tccttgtgcgtgcgatcggatcgcaaagatctgatccgtgcgtggatagacgacaaacta
tccaacaatctgtcgcataagttcttgaccaacgtaaacgatataaaattgttggacact
gaaggaacagagtacattttgggattgtttacaaacggaacaatgccaatggaatatact
agaaataaaacgtcgttaagaataccatcactagaattaatgactgaaacagctattaaa
gtaatttcaaaaaatgaaaatggattttttttaatggtggaaagtgggttaattgatgca
gcacaccatcaaagcacagccaggttagctctagacgaaactgtcgaatttgataagaca
atcaatacttcaatcaatttgctaaaacagttaaacatgttacacgacacattagtgatt
gtgaccagtgaccacgctaacttattatcaattaatggatatccaaatcgagggaataat
attctagctgtggcaggaatatcagaatcagatgatgttccttacacaacattaacgtat
tctataggatatgctaagcgcccagtgtatacccgtcagggtgttttagtcattagacag
aatccaacagcatctgttaatacaactattcatgattatagtcaacaagttggtattccg
gaagagacaggtctacatggtggaagtgacgtagcagtgtatgccaaaggaccaatggga
catttgtttcattccattcacgaacaaaattatattgcccacgcaatagcatatgcaaca
aaaattggtgcttaccaatgtgaacaatcaatgaaccaatcttatatacatttttcaagc
atttacctcatatgcacattaattttgtcattgttgtattttaatgaagttacagtatta
agattttga

DBGET integrated database retrieval system