KEGG   Acyrthosiphon pisum (pea aphid): 100167163Help
Entry
100167163         CDS       T01076                                 

Definition
polyprenol reductase
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     100167163
    1.3.1.94  polyprenol reductase
     100167163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 306 aa AA seqDB search
MDVSFLKIIFAFMAFSIVILSVLINLIESKLPVSIVQTFRYGKFSSEKKHFLVNYLEVPK
NWFKHFYVFAAMWSTLGFVLVILAFVFKVPVPEFIIHFLDMVALKNRRTSYNATATTVAM
LCMLIQCWKRFYETHYLSIFSNSKINISHYAIGYIHYFGCIAAILAEAPSPFTSLSVDHQ
SYFLINDINIRLIIGIIIFLWAFQQQYLANVNLVNLRTDKEGKVITYEHKIPTGGLFDKI
SCPHLFCEMLMYMAIYIMLWGSQIWPYIFFWVLSNQCESAMLNHWWYQSKFKMYPKERYA
FIPYIL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggacgtttcttttttaaagattatttttgcctttatggcattttcaattgtcatttta
agtgttctaattaatttaattgaatctaaattaccggtgtctatagtgcaaacattcagg
tatggtaaattttcaagtgaaaagaaacatttcttggtcaactacttggaagtaccaaaa
aattggttcaaacatttttatgtatttgctgctatgtggtcgacacttggatttgtatta
gtaatactagctttcgtgttcaaagtgcctgttcctgaattcataatacattttctggac
atggtagcactaaagaatcgacggacgtcatacaatgcaactgctactactgttgccatg
ttatgtatgctaattcagtgctggaagcgtttttatgaaacccattatttaagtattttt
tcaaattcgaaaattaatatttctcattacgctattggttatatacattactttggttgt
atagcagccattttagctgaagcgccttcgcctttcacctcactttctgttgatcatcag
tcctacttcttaattaatgatataaacattagactgatcattggaattattatctttctg
tgggctttccaacaacagtatttggcaaatgtaaatttggttaacttgagaacagataaa
gaaggaaaagttattacatatgagcacaaaattccaactggtggtttatttgacaaaata
tcttgccctcatttattttgtgaaatgcttatgtatatggccatatacatcatgctttgg
ggaagtcagatttggccttacatttttttttgggtattgagtaatcagtgtgagtctgca
atgcttaatcattggtggtatcaatcaaaattcaaaatgtatcctaaagaaagatatgcg
ttcattccatacatattataa

DBGET integrated database retrieval system