KEGG   Acyrthosiphon pisum (pea aphid): 100167209Help
Entry
100167209         CDS       T01076                                 

Definition
josephin-like protein-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100167209
Peptidases [BR:api01002]
 Cysteine Peptidases
  Family C86
   100167209
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 195 aa AA seqDB search
MLPESTTIYHEKQSKELCALHALNNLFQSKEAFKQMELDAICFSLSPNNYINPHRSILGI
GNYDVNVLIAALQNKGYSAFWFDKRKDPKMLKLDKIFGFVMNIPSECRLGFLWLPLKRRH
WISIKNINGIYYNLDSKLPNPSPIGNEEDLFNYFRNQLHINDNQLFVVVTGDNYNWIASE
DSSVDQQQIQSLDNR
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgttaccggaatctacaactatttatcatgaaaaacaatccaaggagttatgtgcatta
cacgctctcaacaatttgtttcaatcaaaagaggcattcaagcaaatggaacttgatgct
atatgtttttcactgtcacccaacaactatataaatccacatcgttcgattttaggtatc
ggtaactatgatgtcaacgttttgattgctgcattacaaaacaaaggctatagtgccttt
tggtttgataaaagaaaggacccaaaaatgttgaaattggataaaatatttgggtttgta
atgaacatacccagtgaatgtcgtttaggatttttatggttaccattaaaacgaagacat
tggatatctatcaaaaatattaatggaatttattacaatctagattcaaaattacctaat
ccatcaccaattggaaatgaagaagatctttttaattatttcagaaaccaacttcatata
aatgacaatcaattatttgttgttgttactggtgataattataattggattgcatcagaa
gactcttcagttgatcaacaacaaatacagtcacttgataacagatag

DBGET integrated database retrieval system