KEGG   Acyrthosiphon pisum (pea aphid): 100167276Help
Entry
100167276         CDS       T01076                                 

Definition
glucosylceramidase-like
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:api00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:api00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:api04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 439 aa AA seqDB search
MAAQPKWILSMVAIMTMTGLTDAATAADDCLPRKFAYGTVCVCNSTYCDRTPEPETLSAG
KYALYTSSNAGSRMRRSSGSFVPSLDSQWSGDEIDVDATTTYQTIHGFGGAFTDSVGINV
MALSPNTQLNLLKSYFADDGIKYNIGRVPIGGTDFSTRKYTYADSKGIPDLNNFDLAPED
AEYKIPLIKTAMSMASDEIKLIGSAWSAPPWMKTNNDYSGIGFLKPAFMETWAEYHLKFL
DAYSKQNLTFWALTTGNEPLNGIVPVNRFNSMGWTPMSHREWIGRHMGPRLRGSEYNRTL
LFAIDDQRIVLPWWMKMLMSDEQCAKYIDGIAVHWYLDFIVPVKVLNEVHKNFGDKIIMN
TEASQGDKPWDFVKVQLGSWTRAENYANNIIDAIAMSIRFWSWMAALEGLRLVVVNRVSS
AKSESVALLFRGISFVYAE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggctgcacaaccgaaatggatattgtcgatggtggcaataatgacgatgactggacta
acggatgctgcgacggccgcggacgactgtttgcccaggaagttcgcgtatggcacggtg
tgcgtgtgcaactcgacgtactgcgatcggacaccggaaccggaaacactgtcggccggc
aagtacgctctgtacacgtcttcgaacgccggaagtcggatgcgcagaagcagcgggtct
ttcgtgccgtcgctcgactcgcaatggtccggcgacgagatagatgtggatgcgacgacc
acgtaccaaaccattcacggtttcggcggcgcgttcacagactcggtgggcatcaatgtc
atggcgctgagcccgaacacccaactcaatcttctcaagtcttatttcgctgacgacggc
atcaagtataacattggacgagtgccgatcggtggtaccgatttctcgacgcgcaaatat
acgtacgccgacagcaaaggcattcctgacctgaacaattttgatctggcccccgaagat
gcagaatacaagataccgctgataaagaccgcaatgagtatggcgtcggatgaaattaag
ttgatcgggtcggcgtggtcggccccgccgtggatgaaaaccaacaacgactattccgga
ataggtttcctcaagccagcattcatggaaacgtgggcggaataccatctaaaatttttg
gacgcgtacagcaaacaaaacctgactttctgggcactgaccacggggaacgaaccgctc
aacggtatcgtgcctgtgaaccgattcaattctatgggctggacaccgatgtcgcaccgc
gaatggatcggacgtcacatggggccccggttaaggggttcagaatacaacagaacgctg
ttgttcgccatcgacgaccaaaggatcgtattgccttggtggatgaaaatgctcatgagc
gacgaacaatgcgcaaagtacatcgatggaatagccgtgcactggtacttagactttatc
gttcctgttaaagttttgaatgaagtgcacaaaaactttggtgacaagatcataatgaac
actgaagcgtcgcaaggtgacaaaccgtgggatttcgtcaaagtgcaattgggaagttgg
accagagcagaaaattacgcgaacaacattatcgacgcaattgctatgtcaatccgtttt
tggagctggatggctgctcttgaggggttgcggttggtggtggttaacagagtgtcatca
gcaaagagcgagagtgtggcgttactgtttagaggtatatcatttgtgtatgcggaatag

DBGET integrated database retrieval system