KEGG   Acyrthosiphon pisum (pea aphid): 100167303Help
Entry
100167303         CDS       T01076                                 

Definition
ras-specific guanine nucleotide-releasing factor 1-like
Orthology
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
api  Acyrthosiphon pisum (pea aphid)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1489 aa AA seqDB search
MLSPKMQRCVRVVDNQLLMLSDRARTDSTLTGNLHKKASDSGRWKNRFFVLYQNILFYYD
YESCNKPSGVILLEGSYCSKLDFSSGTSKVTGKIHPENEHCFVISYNHPQMRQYEFRASS
DTACKTWVNALKQASFNKLLLQKEELEQRHLHLLQVVESEMTAKWQYAQQVDESASEIKK
LRAEKELRPLTSYSGSTTGSFDGGTTGTYSRRQSKDSFIFSDPTTFNVQDSIEMRKIKKV
QSFFRGWLCRRRWKQIVEQYIKSPHAESMRKRNSLVFRMVEAEEEYVSQLEVLVTCFLRP
LRMAASSKKPPCSHEDISSIFLNSETVLFLHQIFYKGLTTRMENWPTLILSDLFDILLPM
LTIYQEYVRNHHYSLQVLTECKQNPAFVNLLERLENKPACHARSLENFLIVPMHQIPRYI
ITLHEILAHTPHDHVERKSLQTACQKLEDLSRQIHDEVSETENLRKNLSIERMIIEGCDI
LLDVNQIFVRQGTLVQMPIARKKSRIPHFKTEKEAVRQCFLFTNHMIITTRTTSGKLHLA
PEVGKISLADCRLIEDPNDKEDDNNNPGDLEIPDGNNEADDSAGTSHSSDVENSDCEGLK
CSSSPSPSPSPKPQNYDFQLCVDCKSSTPIAVHLYAPSLQEKTAWVSDISQCIENLRFDA
MLRNSMSDTSSVTMPNSMRDPKLFKDDKDIKFSKYYNSCRIPRIHHATKEKLISRLVDLR
FLSIDFLNTFLLTYRVFTDGVTILEALKKVFYNNEVDAYENIGQPMNNTSLDRSELHNNH
HLTTGDRDRRPSVISSNRKNSAASSVSGYGSEISDRDRSSSVDYQHSPRGRKYSFRKLEE
EERKNKVKVSEEYSSTTSLYQQPSPGRKVSILIEDTGDNCHLAPPTMVKATSSSSNETLT
GDNQSTVVATSPCSNNSSSTLVAATSNCEKSLNDNKISSLPKASPPERKIQSPSKGFPIH
HGHAIKFGSIISDAAKELVEKFHSEKHFSTPQPRRRSWFNHDCTPTIRKKSFGVCEDDMG
GTDENGWLSNLHSASSSRSASLANSSIAQYFSRRKSFACAGDADGCYSGSISQRASMQHD
SPPLSSRVGVVITSSRQSKRRSSTSTAAAAFAIATSASSNPRELSPLHDQRCCSVERKRK
ESVMSTAATMRVLNVLKHWISKHPQDFENETRLKNMTIDFLEDILFSPNLLPAEHKIAGQ
LLRLLTMDETKKPTVDLNLLLTPSQIPSSENIDTLSALEIAEQMTYIDHQIFIRIQSQEF
FGRAWMKDDKNIKAPHIILMTKRFNELSQLVASEIMRKNNVASRVIAIEKWAAVADISRC
LHNFNGVLQICSAFTNSSVFRLKKTWEKVSKATKLSVQKLQIIVSSDGRFRNLREALHRC
DPPCIPYLGMYLSDLSFLEEGTPSLADDGLLNFSKLRMIAHVVQEIRRFQQTPYKIDFHP
RVANYLLDTSLLLNEDELYTRSLEIEPRPSRLSITTLSNSPLHGGGSSQ
NT seq 4470 nt NT seq  +upstreamnt  +downstreamnt
atgttaagcccgaagatgcaaagatgtgtccgggtggtcgacaatcagctcctgatgttg
tcggaccgcgcccgtactgatagcacactcaccggaaatctccacaaaaaagcgtcagac
agcgggaggtggaagaaccgatttttcgttctctaccagaacatactgttctattacgac
tacgagagctgcaataagccgtccggagtaatactgttagaaggcagttactgctcgaaa
ctagatttttccagcggtacgtcgaaagtcactgggaaaattcatccggaaaatgagcac
tgtttcgtcatttcgtacaaccatcctcaaatgcggcagtacgagttccgcgcgtcgtca
gatacggcttgcaagacttgggtgaacgctttgaagcaagccagtttcaataagttgctg
ctacaaaaagaagagctcgaacaacggcacttgcatttgctacaggtcgtcgagagcgaa
atgactgcaaaatggcagtacgcccaacaggtcgatgaatcggcctcagaaatcaaaaaa
ctacgcgcagaaaaggagctgcgaccgttgacatcgtacagcgggtccaccaccggatcg
ttcgacggtgggacgacgggcacgtactcgcgaagacaatccaaagacagcttcatattc
tctgacccgaccacattcaacgtccaggactcgatcgagatgcgcaagatcaagaaagtt
cagagtttctttaggggatggctgtgcaggagacggtggaaacaaatcgtcgaacagtac
atcaaaagtcctcacgccgagagcatgcgcaagagaaacagtctggtttttcgcatggtc
gaagccgaggaagagtacgtgagccagctggaggtgttggtcacttgtttcctgcgcccc
ttgcggatggcggccagctcaaagaagccaccgtgctctcacgaagacataagttcaata
ttcttgaacagcgagacagtgctgttcctgcaccagatattctacaaggggctaacgacc
agaatggaaaactggcctactctaatcctgagcgatctcttcgacatactactgcccatg
ctgacaatctaccaggaatatgtaagaaatcatcattacagtttacaagtgttgaccgaa
tgcaaacaaaaccctgcatttgttaaccttttggaacgattggaaaacaaaccagcatgc
catgcacggtcattggaaaacttcttaatagtaccaatgcatcagattcctagatacata
ataactcttcatgagatattagcacatacgccccacgaccatgtggaaagaaaaagtttg
caaacagcctgtcagaaactggaagacctgagcagacaaattcatgatgaagttagcgaa
actgaaaatttacgaaaaaacctttccatcgaacgaatgattatcgaaggctgtgatatt
ctactagacgtcaatcaaatatttgtcagacagggtactttggtacaaatgccaattgct
agaaaaaagagcaggataccccatttcaaaactgaaaaagaagcagtaagacagtgcttt
ctatttacgaaccatatgataatcacaactaggaccactagtggaaaattacatttggct
cctgaagttggaaaaatatctttggcagactgtcgtttaatagaagaccctaatgataaa
gaggacgacaataacaatccaggagaccttgaaattccagatggaaacaacgaagctgat
gattcggcgggtacaagtcattcgagtgatgttgagaatagcgattgtgaaggcttaaaa
tgttcatctagtccaagtccaagtcctagtccaaaaccacaaaattatgattttcaactt
tgtgttgattgcaaatcgtctacacctattgcagttcatttgtatgcaccatctttacaa
gaaaaaactgcgtgggtcagtgatattagtcaatgtattgaaaacttaagatttgacgca
atgcttcgaaattcaatgtcagatacgtcatctgtgacaatgccgaattcaatgcgtgat
ccaaagctttttaaagatgacaaagatatcaaatttagcaaatattataattcctgtagg
attccgcgtattcaccatgctacaaaagaaaaactgatatctagacttgtggatttaagg
tttttatcaattgattttctcaatacatttcttctcacatatagagtttttactgatgga
gttaccattttggaagcgttaaaaaaggtgttttataacaatgaagtagatgcatatgaa
aatatcggacaacctatgaataacacgtcattagatcgaagtgaattgcataacaatcat
catctcaccacaggggatagagacagaagacccagcgttatttcgtcaaaccgaaagaat
agtgccgccagttctgtatccggctacggatcagagatcagtgaccgggatagaagttcc
agtgtggattatcagcatagtccgagaggaagaaaatatagttttcgaaaacttgaagaa
gaggaaagaaaaaataaagtaaaagtgtctgaagaatacagttcaactactagtttatac
cagcaaccttcaccgggacgaaaagtgagcatactaatcgaagacactggtgacaattgt
catttagcccctcctactatggttaaagcaacttcatcatctagtaatgagactctgact
ggagataaccaatcaacagtagttgcaacatctccatgtagcaataatagtagttcgacc
ttagtagctgcgacttctaattgtgagaaaagtcttaatgacaataaaatcagtagtttg
ccaaaagcatctccaccagaacgtaaaatacaatcgccttcaaaaggttttcccattcac
cacggacatgcgatcaaatttgggtccataatatcagatgcagctaaagaactcgtagaa
aagttccattcagaaaagcatttttctaccccacaaccgcgtaggagaagttggttcaat
cacgattgtactccaactataaggaaaaagagttttggagtttgcgaggacgatatgggt
ggcactgatgaaaacggatggctcagtaacctgcatagtgcatcatcatcaagatcagct
tcacttgcaaactctagcatcgcacagtatttctctagaagaaaatcatttgcatgcgct
ggtgatgctgatggctgttacagcggaagcatatcacagagagctagcatgcaacacgat
agccctccactatctagtcgtgtcggtgttgtaataacgtcatcgagacaatcaaaaaga
aggagcagcacgtctactgctgctgcagcgtttgctatcgcaacgtcagcttcgagtaac
cctcgggaactctctccattacatgatcaaagatgttgttcagtagaacgaaaaagaaaa
gagtctgtaatgtccactgcagctacgatgcgggtgttaaatgtcttaaaacattggata
tcaaaacacccacaagattttgaaaatgaaacacgtcttaagaacatgactatagacttt
ttagaagacatactcttcagtcccaatcttttaccagccgagcacaaaatagctggtcaa
ttacttagattacttacaatggacgaaacaaaaaaacctactgtcgacctaaacttgctg
ttgactccatctcaaattcccagttctgaaaatatcgacacattgtctgcattagaaatt
gctgaacaaatgacttatatcgatcatcaaatatttataagaatccaaagccaggaattt
ttcggccgtgcgtggatgaaagacgacaagaacataaaagcgcctcacattattctaatg
actaagagatttaacgagttgtcgcagctggtcgcttcagaaataatgcgtaagaacaat
gtggcttcaagagtgatagcaatagaaaagtgggccgcggtggccgacatatctaggtgc
ttgcataattttaacggagtcctacaaatatgttcggcttttaccaatagttcggtgttc
agattgaagaaaacgtgggagaaagtttcaaaagctacaaaactgtcagttcaaaaactt
cagataatcgtctcgtctgacggaagattcagaaaccttcgcgaagctctgcacagatgc
gatccaccgtgtattccgtacttggggatgtacctgagtgatttatcgtttttagaagaa
gggactcccagtttggcagatgacggtctacttaacttttcaaaattgcgtatgatcgcg
cacgtggtacaggaaatccgccggtttcagcaaacgccgtacaagatcgacttccatccg
agagtggccaactacctgttggacacgtcactgctcttgaacgaggacgagctgtacacc
aggtccttggagatcgaacctcggccgtccaggctcagcatcacgacgctgtcgaactcg
cctctccacggcggcggtagcagccaatga

DBGET integrated database retrieval system