KEGG   Acyrthosiphon pisum (pea aphid): 100167303Help
Entry
100167303         CDS       T01076                                 

Definition
ras-specific guanine nucleotide-releasing factor 2-like
Orthology
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
api  Acyrthosiphon pisum (pea aphid)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1501 aa AA seqDB search
MLSPKMQRCVRVVDNQLLMLSDRARTDSTLTGNLHKKASDSGRWKNRFFVLYQNILFYYD
YESCNKPSGVILLEGSYCSKLDFSSGTSKVTGKIHPENEHCFVISYNHPQMRQYEFRASS
DTACKTWVNALKQASFNKLLLQKEELEQRHLHLLQVVESEMTAKWQYAQQVDESASEIKK
LRAEVLTLKKELRPLTSYSGSTTGSFDGGTTGTYSRRQSKDSFIFSDPTTFNVQDSIEMR
KIKKVQSFFRGWLCRRRWKQIVEQYIKSPHAESMRKRNSLVFRMVEAEEEYVSQLEVLVT
CFLRPLRMAASSKKPPCSHEDISSIFLNSETVLFLHQIFYKGLTTRMENWPTLILSDLFD
ILLPMLTIYQEYVRNHHYSLQVLTECKQNPAFVNLLERLENKPACHARSLENFLIVPMHQ
IPRYIITLHEILAHTPHDHVERKSLQTACQKLEDLSRQIHDEVSETENLRKNLSIERMII
EGCDILLDVNQIFVRQGTLVQMPIARKKSRIPHFKTEKEAVRQCFLFTNHMIITTRTTSG
KLHLAPEVGKISLADCRLIEDPNDKEDDNNNPGDLEIPDGNNEADDSAGTSHSSDVENSD
CEGLKCSSSPSPSPSPKPQNYDFQLCVDCKSSTPIAVHLYAPSLQEKTAWVSDISQCIEN
LRFDAMLRNSMSDTSSVTMPNSMRDPKLFKDDKDIKFSKYYNSCRIPRIHHATKEKLISR
LVDLRFLSIDFLNTFLLTYRVFTDGVTILEALKKVFYNNEVDAYENIGQPMNNTSLDRSE
LHNNHHLTTGDRDRRPSVISSNRKNSAASSVSGYGSEISDRDRSSSVDYQHSPRGRKYSF
RKLEEEERKNKVKVSEEYSSTTSLYQQPSPGRKVSILIEDTGDNCHLAPPTMVKATSSSS
NETLTGDNQSTVVATSPCSNNSSSTLVAATSNCEKSLNDNKISSLPKASPPERKIQSPSK
GFPIHHGHAIKFGSIISDAAKELVEKFHSEKHFSTPQPRRRSWFNHDCTPTIRKKSFGVC
EDDMGGTDENGWLSNLHSASSSRSASLANSSIAQYFSRRKSFACAGDADGCYSGSISQRA
SMQHDSPPLSSRVGVVITSSRQSKRRTGRPEFWSSTSTAAAAFAIATSASSNPRELSPLH
DQRCCSVERKRKESVMSTAATMRVLNVLKHWISKHPQDFENETRLKNMTIDFLEDILFSP
NLLPAEHKIAGQLLRLLTMDETKKPTVDLNLLLTPSQIPSSENIDTLSALEIAEQMTYID
HQIFIRIQSQEFFGRAWMKDDKNIKAPHIILMTKRFNELSQLVASEIMRKNNVASRVIAI
EKWAAVADISRCLHNFNGVLQICSAFTNSSVFRLKKTWEKVSKATKLSVQKLQIIVSSDG
RFRNLREALHRCDPPCIPYLGMYLSDLSFLEEGTPSLADDGLLNFSKLRMIAHVVQEIRR
FQQTPYKIDFHPRVANYLLDTSLLLNEDELYTRSLEIEPRPSRLSITTLSNSPLHGGGSS
Q
NT seq 4506 nt NT seq  +upstreamnt  +downstreamnt
atgttaagcccgaagatgcaaagatgtgtccgggtggtcgacaatcagctcctgatgttg
tcggaccgcgcccgtactgatagcacactcaccggaaatctccacaaaaaagcgtcagac
agcgggaggtggaagaaccgatttttcgttctctaccagaacatactgttctattacgac
tacgagagctgcaataagccgtccggagtaatactgttagaaggcagttactgctcgaaa
ctagatttttccagcggtacgtcgaaagtcactgggaaaattcatccggaaaatgagcac
tgtttcgtcatttcgtacaaccatcctcaaatgcggcagtacgagttccgcgcgtcgtca
gatacggcttgcaagacttgggtgaacgctttgaagcaagccagtttcaataagttgctg
ctacaaaaagaagagctcgaacaacggcacttgcatttgctacaggtcgtcgagagcgaa
atgactgcaaaatggcagtacgcccaacaggtcgatgaatcggcctcagaaatcaaaaaa
ctacgcgcagaagtgttaacattaaagaaggagctgcgaccgttgacatcgtacagcggg
tccaccaccggatcgttcgacggtgggacgacgggcacgtactcgcgaagacaatccaaa
gacagcttcatattctctgacccgaccacattcaacgtccaggactcgatcgagatgcgc
aagatcaagaaagttcagagtttctttaggggatggctgtgcaggagacggtggaaacaa
atcgtcgaacagtacatcaaaagtcctcacgccgagagcatgcgcaagagaaacagtctg
gtttttcgcatggtcgaagccgaggaagagtacgtgagccagctggaggtgttggtcact
tgtttcctgcgccccttgcggatggcggccagctcaaagaagccaccgtgctctcacgaa
gacataagttcaatattcttgaacagcgagacagtgctgttcctgcaccagatattctac
aaggggctaacgaccagaatggaaaactggcctactctaatcctgagcgatctcttcgac
atactactgcccatgctgacaatctaccaggaatatgtaagaaatcatcattacagttta
caagtgttgaccgaatgcaaacaaaaccctgcatttgttaaccttttggaacgattggaa
aacaaaccagcatgccatgcacggtcattggaaaacttcttaatagtaccaatgcatcag
attcctagatacataataactcttcatgagatattagcacatacgccccacgaccatgtg
gaaagaaaaagtttgcaaacagcctgtcagaaactggaagacctgagcagacaaattcat
gatgaagttagcgaaactgaaaatttacgaaaaaacctttccatcgaacgaatgattatc
gaaggctgtgatattctactagacgtcaatcaaatatttgtcagacagggtactttggta
caaatgccaattgctagaaaaaagagcaggataccccatttcaaaactgaaaaagaagca
gtaagacagtgctttctatttacgaaccatatgataatcacaactaggaccactagtgga
aaattacatttggctcctgaagttggaaaaatatctttggcagactgtcgtttaatagaa
gaccctaatgataaagaggacgacaataacaatccaggagaccttgaaattccagatgga
aacaacgaagctgatgattcggcgggtacaagtcattcgagtgatgttgagaatagcgat
tgtgaaggcttaaaatgttcatctagtccaagtccaagtcctagtccaaaaccacaaaat
tatgattttcaactttgtgttgattgcaaatcgtctacacctattgcagttcatttgtat
gcaccatctttacaagaaaaaactgcgtgggtcagtgatattagtcaatgtattgaaaac
ttaagatttgacgcaatgcttcgaaattcaatgtcagatacgtcatctgtgacaatgccg
aattcaatgcgtgatccaaagctttttaaagatgacaaagatatcaaatttagcaaatat
tataattcctgtaggattccgcgtattcaccatgctacaaaagaaaaactgatatctaga
cttgtggatttaaggtttttatcaattgattttctcaatacatttcttctcacatataga
gtttttactgatggagttaccattttggaagcgttaaaaaaggtgttttataacaatgaa
gtagatgcatatgaaaatatcggacaacctatgaataacacgtcattagatcgaagtgaa
ttgcataacaatcatcatctcaccacaggggatagagacagaagacccagcgttatttcg
tcaaaccgaaagaatagtgccgccagttctgtatccggctacggatcagagatcagtgac
cgggatagaagttccagtgtggattatcagcatagtccgagaggaagaaaatatagtttt
cgaaaacttgaagaagaggaaagaaaaaataaagtaaaagtgtctgaagaatacagttca
actactagtttataccagcaaccttcaccgggacgaaaagtgagcatactaatcgaagac
actggtgacaattgtcatttagcccctcctactatggttaaagcaacttcatcatctagt
aatgagactctgactggagataaccaatcaacagtagttgcaacatctccatgtagcaat
aatagtagttcgaccttagtagctgcgacttctaattgtgagaaaagtcttaatgacaat
aaaatcagtagtttgccaaaagcatctccaccagaacgtaaaatacaatcgccttcaaaa
ggttttcccattcaccacggacatgcgatcaaatttgggtccataatatcagatgcagct
aaagaactcgtagaaaagttccattcagaaaagcatttttctaccccacaaccgcgtagg
agaagttggttcaatcacgattgtactccaactataaggaaaaagagttttggagtttgc
gaggacgatatgggtggcactgatgaaaacggatggctcagtaacctgcatagtgcatca
tcatcaagatcagcttcacttgcaaactctagcatcgcacagtatttctctagaagaaaa
tcatttgcatgcgctggtgatgctgatggctgttacagcggaagcatatcacagagagct
agcatgcaacacgatagccctccactatctagtcgtgtcggtgttgtaataacgtcatcg
agacaatcaaaaagaagaactggaaggccggagttttggagcagcacgtctactgctgct
gcagcgtttgctatcgcaacgtcagcttcgagtaaccctcgggaactctctccattacat
gatcaaagatgttgttcagtagaacgaaaaagaaaagagtctgtaatgtccactgcagct
acgatgcgggtgttaaatgtcttaaaacattggatatcaaaacacccacaagattttgaa
aatgaaacacgtcttaagaacatgactatagactttttagaagacatactcttcagtccc
aatcttttaccagccgagcacaaaatagctggtcaattacttagattacttacaatggac
gaaacaaaaaaacctactgtcgacctaaacttgctgttgactccatctcaaattcccagt
tctgaaaatatcgacacattgtctgcattagaaattgctgaacaaatgacttatatcgat
catcaaatatttataagaatccaaagccaggaatttttcggccgtgcgtggatgaaagac
gacaagaacataaaagcgcctcacattattctaatgactaagagatttaacgagttgtcg
cagctggtcgcttcagaaataatgcgtaagaacaatgtggcttcaagagtgatagcaata
gaaaagtgggccgcggtggccgacatatctaggtgcttgcataattttaacggagtccta
caaatatgttcggcttttaccaatagttcggtgttcagattgaagaaaacgtgggagaaa
gtttcaaaagctacaaaactgtcagttcaaaaacttcagataatcgtctcgtctgacgga
agattcagaaaccttcgcgaagctctgcacagatgcgatccaccgtgtattccgtacttg
gggatgtacctgagtgatttatcgtttttagaagaagggactcccagtttggcagatgac
ggtctacttaacttttcaaaattgcgtatgatcgcgcacgtggtacaggaaatccgccgg
tttcagcaaacgccgtacaagatcgacttccatccgagagtggccaactacctgttggac
acgtcactgctcttgaacgaggacgagctgtacaccaggtccttggagatcgaacctcgg
ccgtccaggctcagcatcacgacgctgtcgaactcgcctctccacggcggcggtagcagc
caatga

DBGET integrated database retrieval system