KEGG   Acyrthosiphon pisum (pea aphid): 100167375Help
Entry
100167375         CDS       T01076                                 

Definition
regulatory-associated protein of mTOR-like
Orthology
K07204  
regulatory associated protein of mTOR
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:api04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1289 aa AA seqDB search
MEETSSKLSSGSADAAESADWQLPLCFTKKRHTEEIKPVDAVVNSWRLKERMKTVSVALV
MCLNVGVDPPDVLKVQPCARLECWIDPLMMVPQKALEIIGVNLQKQYERWQPRARYKQSL
DPTIEEVKKLCVSLRRNAKEERVLFHYNGHGVPKPTVNGEIWVFNRTYTQYIPLSIYDLQ
SWMGSPSIYVYDCSNAGMIIKLFSQFAEQHEKEDLHNATQSPLFVGAEGSSFKNCIQLGA
CQIDQTLPMHPDLPADLFTSCLTTPIKMAARWFVMQNMSKHGSKLFLELVDKIPGTLNDR
RTMLGELNWVFTAITDTIAWNILPRDTFQTLFRQDLLVASLLRNFLLAERIMRTYDCEPV
SSPKLPAMHNHPMWQSWDHILDLCLSQLQRFQDNSDGVFVRTTFFEEQLTAFEIWLDHTA
CLPTQQRSAPEQLPIVLQVLLSQAHRLRALDLLGRFLDLGPWAVNLTLSVGIFPYILKLL
QSFAVELRPMLAFIWAKIMAVDHTCQTDIVRENGFKYFFQLVEDIRLPEEQRMLGTVVLS
RLMQNYKNGQQLGLKNNLVCICLEQLANASAPYKQWLTLCLAQLWSDYDKARWVGVRDIA
HEKLYILLEDKIPEVRAAAVFALGTYVSCDKDRTNYAIKVDLNIALTLLNTVAKDMSPMV
REEVIIALQWTVITFERYFLEIAMQEQIEKSYGSIYKSPNGNSKTASLSRMGSKEKLSMQ
PNCFIVTVVSPQISPGPSISDEMQEETKSENLRRTNSSSSIVTLDAYQTTSAYNNNHSTL
WKGLTALEHDIFPDVSATAQKLTKYIRQKLKNKPDSRASHSLPASPSSRSYLSQGDSPPL
SVHEIRTRQRPPITPSRSNSRTKKIVPNTIVEETTVLSSSSSPPNIESDSEKDTTNITKS
LLRSQFFEWVSKNFAHPLSGMNDGGDFESAIYYERDWRYTRNMMLRKEAQEEQNKVNNLN
CKIEHQIFSSKCKQSPNSLVFFPYDPHVIVATKDYLTVWDYHSSYKLCQWKPDVRSHNLD
LSYRLTPHLSAVELINSHDVPLVLAGYNDGNIQVWSQCIDGPPKLVSGWHALPICKSPSF
ESSSMALQWDQRSCHLICAGDSRVIKIWDIETETKLTALSTGVNASVTTMSMQSKENNIF
AAGCKDGSIKVFDKRLPPDEAKIASFIGHHSKILTLRLQDATVVSASAYGDIKTFEFGHN
APQHEFHVNNMQSAAIHSMCNIIACSSINQMLLFYNTEGQLLNSLKLTDWFMSTRYSPLM
TTKFHPQKVLLSTGAMDGTIALYSIDPKR
NT seq 3870 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaacgtcgtccaaactatcgtccggcagcgccgacgccgccgagtccgccgac
tggcagttgccgttgtgcttcacgaagaagcgtcatacggaggagatcaagcctgtggac
gccgtggtaaactcatggcgtctcaaagaacggatgaagactgtgagtgttgctcttgtc
atgtgcctgaacgtaggtgtagacccaccggacgttttaaaagtgcagccttgcgcccgt
ctagaatgttggatagatccattgatgatggtccctcagaaagcactggaaataattgga
gtcaatttgcaaaaacagtacgaaaggtggcagccaagagcgcggtacaaacaatcatta
gacccgactatagaggaagtaaaaaaattgtgcgtttccttgagacgaaatgcaaaagaa
gaaagagtactgttccactataatggacatggagttccaaaacctacagtaaatggtgaa
atttgggtgtttaacaggacatatacccaatacattccattgtccatatacgatcttcaa
tcttggatgggatcaccatcaatttatgtctatgattgttcaaatgcaggaatgattata
aaattatttagccaatttgctgaacagcatgaaaaagaagatttgcataatgctacccaa
agcccattgtttgttggtgctgaaggttcttctttcaaaaattgcattcaactaggtgca
tgtcaaatagatcaaacacttccaatgcatccagacttgcctgcagatttatttacttcc
tgcttgactacaccaattaaaatggctgctcggtggtttgtaatgcaaaatatgtcaaaa
catggttcaaaattatttctagaacttgttgataaaattcctggtacattaaatgatcga
cgaacaatgttaggagaattaaactgggtatttactgctattactgatacaatagcttgg
aacatattacctagagatacttttcaaacgttatttcggcaagacttgttagttgcgagt
ctactaagaaactttttacttgctgaacgcattatgagaacatatgactgtgaaccagta
tcttcacctaaattaccggcaatgcacaatcatcccatgtggcagtcatgggatcatatt
ttagatttatgtttatctcaattacaacgttttcaagataacagtgatggtgtctttgta
cgcacaacattttttgaagaacaattgactgcatttgaaatttggcttgatcatacagct
tgtttaccaacgcaacaacgtagtgcacctgaacagcttcccattgtactccaagttcta
ttaagtcaagcacatagacttcgagcattagacttgttgggtagatttttagatttagga
ccgtgggctgtaaatttaactttatctgtaggaatatttccttatatattaaaactactg
cagagttttgccgtcgaacttcgcccaatgttagcttttatttgggctaaaataatggct
gttgatcatacttgtcaaactgacattgtgagggaaaatggttttaaatacttttttcaa
ctggttgaagatatacgcttgcctgaagaacaaaggatgttgggaactgtcgtgctctct
cgactaatgcaaaactacaagaatggccaacaacttgggttaaagaacaatttagtgtgc
atatgtcttgaacaattagccaatgctagcgctccgtataaacagtggttaaccttgtgt
cttgcacagctatggtctgattatgataaagctcgttgggttggtgtacgggatatagct
catgaaaaactttacattttactagaagataaaataccagaagttcgggctgcagcagtg
tttgctcttggtacttatgtgagctgtgataaggaccgtactaactatgctataaaagtt
gatctaaatattgctttgactttattaaatactgtcgctaaagatatgagccctatggtc
agggaggaagttataattgctctccaatggactgtcatcacatttgaaagatatttttta
gaaatagcaatgcaggaacaaattgaaaagtcatatggatctatttataaaagtccaaat
ggaaactcaaaaacagctagtctgtcgagaatgggatccaaagagaagctctcaatgcag
cctaattgttttatagtcacagtagtatcacctcaaatatcgcctggacctagcatttca
gatgaaatgcaagaagaaacaaaatctgaaaatttaaggcgaacaaattcttcctcgtca
atagttaccttggatgcttatcaaacaacatcagcctataacaataatcactctacatta
tggaaaggtttgacagctttggaacacgatatattcccagatgtttcagccactgcacaa
aaattaactaaatacattagacagaagcttaaaaacaagcctgatagtcgtgcatcacat
tcattacctgcatctccatcttctagaagttatctcagtcaaggagattctcctccattg
tctgtacatgaaattcgtactcgacaaagaccacctattacaccatcaagatcaaattct
aggacaaaaaaaatcgtgcccaacaccattgtagaagaaactactgtgctttcatcatca
tcttcaccaccaaacatagaaagtgatagtgaaaaggacacaacaaatataactaaaagc
ttattgagatctcaatttttcgaatgggtatctaaaaattttgctcatccattgagtggt
atgaacgatggtggtgactttgagagtgcaatatactatgaacgtgactggaggtataca
cgaaacatgatgcttcgtaaagaagcacaagaagaacaaaataaagtaaataatttaaat
tgtaagatagaacatcaaatattctcatcaaaatgtaaacaatccccaaactcactggtc
ttttttccatatgacccacatgtcattgtagctacaaaagattatttaacagtatgggat
tatcatagtagctataagttgtgccaatggaaaccagatgtcagaagtcacaatcttgat
ttgtcatatagattaactccgcatttatctgctgtagaactgattaacagccacgatgtt
cctttagtgctggctggttacaatgatggaaatattcaagtatggtctcaatgcatcgat
ggtccacccaaattggtttccggttggcatgcattacctatttgcaagagtccaagtttt
gagagttcttcgatggctttgcaatgggatcaaaggtcgtgccatttaatttgtgcaggt
gactcaagagttattaaaatctgggatattgagactgaaactaaactgactgctttatcc
acgggtgttaatgcttctgtgacgactatgtccatgcaatctaaagaaaataatatattt
gctgctggttgtaaagatgggtcaattaaagtatttgataaaagacttccaccagacgaa
gcaaaaatagcttctttcatagggcatcatagtaaaatactcactttaagactacaagat
gctacagtagtatctgctagtgcttatggagatataaaaacatttgagtttggtcataat
gctccacagcatgaatttcatgtcaacaacatgcaatctgcagccatacactcaatgtgc
aatataatagcatgcagtagtataaatcaaatgttgttattctacaacacagagggtcag
ttgttaaactctctgaaattaacagactggttcatgagtacacgttattcaccattaatg
accaccaagtttcacccacaaaaagtgctgctttctaccggggcaatggacggaactata
gcattatactcaattgatcccaaaagatga

DBGET integrated database retrieval system