KEGG   Acyrthosiphon pisum (pea aphid): 100167375Help
Entry
100167375         CDS       T01076                                 

Definition
(RefSeq) regulatory-associated protein of mTOR
  KO
K07204  regulatory associated protein of mTOR
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api04136  Autophagy - other
api04140  Autophagy - animal
api04150  mTOR signaling pathway
api04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:api00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    100167375
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100167375
   04136 Autophagy - other eukaryotes
    100167375
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    100167375
Membrane trafficking [BR:api04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    100167375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Raptor_N HEAT HEAT_2
Motif
Other DBs
NCBI-GeneID: 100167375
NCBI-ProteinID: XP_001949168
APHIDBASE: ACYPI008174
Position
Un
AA seq 1289 aa AA seqDB search
MEETSSKLSSGSADAAESADWQLPLCFTKKRHTEEIKPVDAVVNSWRLKERMKTVSVALV
MCLNVGVDPPDVLKVQPCARLECWIDPLMMVPQKALEIIGVNLQKQYERWQPRARYKQSL
DPTIEEVKKLCVSLRRNAKEERVLFHYNGHGVPKPTVNGEIWVFNRTYTQYIPLSIYDLQ
SWMGSPSIYVYDCSNAGMIIKLFSQFAEQHEKEDLHNATQSPLFVGAEGSSFKNCIQLGA
CQIDQTLPMHPDLPADLFTSCLTTPIKMAARWFVMQNMSKHGSKLFLELVDKIPGTLNDR
RTMLGELNWVFTAITDTIAWNILPRDTFQTLFRQDLLVASLLRNFLLAERIMRTYDCEPV
SSPKLPAMHNHPMWQSWDHILDLCLSQLQRFQDNSDGVFVRTTFFEEQLTAFEIWLDHTA
CLPTQQRSAPEQLPIVLQVLLSQAHRLRALDLLGRFLDLGPWAVNLTLSVGIFPYILKLL
QSFAVELRPMLAFIWAKIMAVDHTCQTDIVRENGFKYFFQLVEDIRLPEEQRMLGTVVLS
RLMQNYKNGQQLGLKNNLVCICLEQLANASAPYKQWLTLCLAQLWSDYDKARWVGVRDIA
HEKLYILLEDKIPEVRAAAVFALGTYVSCDKDRTNYAIKVDLNIALTLLNTVAKDMSPMV
REEVIIALQWTVITFERYFLEIAMQEQIEKSYGSIYKSPNGNSKTASLSRMGSKEKLSMQ
PNCFIVTVVSPQISPGPSISDEMQEETKSENLRRTNSSSSIVTLDAYQTTSAYNNNHSTL
WKGLTALEHDIFPDVSATAQKLTKYIRQKLKNKPDSRASHSLPASPSSRSYLSQGDSPPL
SVHEIRTRQRPPITPSRSNSRTKKIVPNTIVEETTVLSSSSSPPNIESDSEKDTTNITKS
LLRSQFFEWVSKNFAHPLSGMNDGGDFESAIYYERDWRYTRNMMLRKEAQEEQNKVNNLN
CKIEHQIFSSKCKQSPNSLVFFPYDPHVIVATKDYLTVWDYHSSYKLCQWKPDVRSHNLD
LSYRLTPHLSAVELINSHDVPLVLAGYNDGNIQVWSQCIDGPPKLVSGWHALPICKSPSF
ESSSMALQWDQRSCHLICAGDSRVIKIWDIETETKLTALSTGVNASVTTMSMQSKENNIF
AAGCKDGSIKVFDKRLPPDEAKIASFIGHHSKILTLRLQDATVVSASAYGDIKTFEFGHN
APQHEFHVNNMQSAAIHSMCNIIACSSINQMLLFYNTEGQLLNSLKLTDWFMSTRYSPLM
TTKFHPQKVLLSTGAMDGTIALYSIDPKR
NT seq 3870 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaacgtcgtccaaactatcgtccggcagcgccgacgccgccgagtccgccgac
tggcagttgccgttgtgcttcacgaagaagcgtcatacggaggagatcaagcctgtggac
gccgtggtaaactcatggcgtctcaaagaacggatgaagactgtgagtgttgctcttgtc
atgtgcctgaacgtaggtgtagacccaccggacgttttaaaagtgcagccttgcgcccgt
ctagaatgttggatagatccattgatgatggtccctcagaaagcactggaaataattgga
gtcaatttgcaaaaacagtacgaaaggtggcagccaagagcgcggtacaaacaatcatta
gacccgactatagaggaagtaaaaaaattgtgcgtttccttgagacgaaatgcaaaagaa
gaaagagtactgttccactataatggacatggagttccaaaacctacagtaaatggtgaa
atttgggtgtttaacaggacatatacccaatacattccattgtccatatacgatcttcaa
tcttggatgggatcaccatcaatttatgtctatgattgttcaaatgcaggaatgattata
aaattatttagccaatttgctgaacagcatgaaaaagaagatttgcataatgctacccaa
agcccattgtttgttggtgctgaaggttcttctttcaaaaattgcattcaactaggtgca
tgtcaaatagatcaaacacttccaatgcatccagacttgcctgcagatttatttacttcc
tgcttgactacaccaattaaaatggctgctcggtggtttgtaatgcaaaatatgtcaaaa
catggttcaaaattatttctagaacttgttgataaaattcctggtacattaaatgatcga
cgaacaatgttaggagaattaaactgggtatttactgctattactgatacaatagcttgg
aacatattacctagagatacttttcaaacgttatttcggcaagacttgttagttgcgagt
ctactaagaaactttttacttgctgaacgcattatgagaacatatgactgtgaaccagta
tcttcacctaaattaccggcaatgcacaatcatcccatgtggcagtcatgggatcatatt
ttagatttatgtttatctcaattacaacgttttcaagataacagtgatggtgtctttgta
cgcacaacattttttgaagaacaattgactgcatttgaaatttggcttgatcatacagct
tgtttaccaacgcaacaacgtagtgcacctgaacagcttcccattgtactccaagttcta
ttaagtcaagcacatagacttcgagcattagacttgttgggtagatttttagatttagga
ccgtgggctgtaaatttaactttatctgtaggaatatttccttatatattaaaactactg
cagagttttgccgtcgaacttcgcccaatgttagcttttatttgggctaaaataatggct
gttgatcatacttgtcaaactgacattgtgagggaaaatggttttaaatacttttttcaa
ctggttgaagatatacgcttgcctgaagaacaaaggatgttgggaactgtcgtgctctct
cgactaatgcaaaactacaagaatggccaacaacttgggttaaagaacaatttagtgtgc
atatgtcttgaacaattagccaatgctagcgctccgtataaacagtggttaaccttgtgt
cttgcacagctatggtctgattatgataaagctcgttgggttggtgtacgggatatagct
catgaaaaactttacattttactagaagataaaataccagaagttcgggctgcagcagtg
tttgctcttggtacttatgtgagctgtgataaggaccgtactaactatgctataaaagtt
gatctaaatattgctttgactttattaaatactgtcgctaaagatatgagccctatggtc
agggaggaagttataattgctctccaatggactgtcatcacatttgaaagatatttttta
gaaatagcaatgcaggaacaaattgaaaagtcatatggatctatttataaaagtccaaat
ggaaactcaaaaacagctagtctgtcgagaatgggatccaaagagaagctctcaatgcag
cctaattgttttatagtcacagtagtatcacctcaaatatcgcctggacctagcatttca
gatgaaatgcaagaagaaacaaaatctgaaaatttaaggcgaacaaattcttcctcgtca
atagttaccttggatgcttatcaaacaacatcagcctataacaataatcactctacatta
tggaaaggtttgacagctttggaacacgatatattcccagatgtttcagccactgcacaa
aaattaactaaatacattagacagaagcttaaaaacaagcctgatagtcgtgcatcacat
tcattacctgcatctccatcttctagaagttatctcagtcaaggagattctcctccattg
tctgtacatgaaattcgtactcgacaaagaccacctattacaccatcaagatcaaattct
aggacaaaaaaaatcgtgcccaacaccattgtagaagaaactactgtgctttcatcatca
tcttcaccaccaaacatagaaagtgatagtgaaaaggacacaacaaatataactaaaagc
ttattgagatctcaatttttcgaatgggtatctaaaaattttgctcatccattgagtggt
atgaacgatggtggtgactttgagagtgcaatatactatgaacgtgactggaggtataca
cgaaacatgatgcttcgtaaagaagcacaagaagaacaaaataaagtaaataatttaaat
tgtaagatagaacatcaaatattctcatcaaaatgtaaacaatccccaaactcactggtc
ttttttccatatgacccacatgtcattgtagctacaaaagattatttaacagtatgggat
tatcatagtagctataagttgtgccaatggaaaccagatgtcagaagtcacaatcttgat
ttgtcatatagattaactccgcatttatctgctgtagaactgattaacagccacgatgtt
cctttagtgctggctggttacaatgatggaaatattcaagtatggtctcaatgcatcgat
ggtccacccaaattggtttccggttggcatgcattacctatttgcaagagtccaagtttt
gagagttcttcgatggctttgcaatgggatcaaaggtcgtgccatttaatttgtgcaggt
gactcaagagttattaaaatctgggatattgagactgaaactaaactgactgctttatcc
acgggtgttaatgcttctgtgacgactatgtccatgcaatctaaagaaaataatatattt
gctgctggttgtaaagatgggtcaattaaagtatttgataaaagacttccaccagacgaa
gcaaaaatagcttctttcatagggcatcatagtaaaatactcactttaagactacaagat
gctacagtagtatctgctagtgcttatggagatataaaaacatttgagtttggtcataat
gctccacagcatgaatttcatgtcaacaacatgcaatctgcagccatacactcaatgtgc
aatataatagcatgcagtagtataaatcaaatgttgttattctacaacacagagggtcag
ttgttaaactctctgaaattaacagactggttcatgagtacacgttattcaccattaatg
accaccaagtttcacccacaaaaagtgctgctttctaccggggcaatggacggaactata
gcattatactcaattgatcccaaaagatga

DBGET integrated database retrieval system