KEGG   Acyrthosiphon pisum (pea aphid): 100167654Help
Entry
100167654         CDS       T01076                                 

Definition
cell division cycle protein 27 homolog
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:api00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100167654
Protein phosphatases and associated proteins [BR:api01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100167654
Ubiquitin system [BR:api04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     100167654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 759 aa AA seqDB search
MIIQEPIQAAIWHCLNHYAYSDAIFLAERLCAEFDSDESIFLLATCYYRSGKPSQAYTIL
SGKKIVSEKCKFLLARCCVDLHKLSEAETVLTGNVGDLISSSSCSSFIETIISDYGDSSP
FALQLISHIWWRSERSHLAAEACRKALYLNPFLWQSFQDLCDRGVKPDPEPTKIFKVDNL
DNFNKCLGSNSHVNSTPLSTYNLSYESVNTFNSSTPAQKMVNMSVPSSNSSISSGIQPFT
PDMNNAKAIFVRPIGRKVKVINENAYSPLTPSFGVFPLENSDNLSVCSSQSMVLVPSATL
NETNDQKFISKRSSKPVFSQSGNTSNINNLGTQQITMPSSPMSHVVRRSSRIITNNCSVK
ENTKSPNKKFASPKSATRKIKSGLIPKKSVFADITERHPKERGVVEVETLTLAQQALNLQ
KKTTEGLLSLLRDIGIAYLQLSKFNCKKAIQLFQSLPPRQYKTGFVLSMIGKAYCEQSDY
LQSIKYFSEVKEHEPYRDTLMELYSTSLWHQQKEVALSALAQDMTALDRNSSSTWCVVGN
CFSLQKEHQTAIKYFQRAIQVNPDFPYAYALLGNEYLVTEELEKAITCFQKAVKLDPRHY
KSWYGIGAIYQKQERYELAEMHYKRALRINHSSALIMCHIAVVQNSMDKPDQALHTLHIA
LTLEPKHPMCKYQRAQIYSKLGKLPEALYELEELKEIVPKESLVYFLTGKVHKKLGNIHL
ALMNFNRATDLDPKGASNQIKEAIDPTNNQSPLDDSDDP
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgattattcaagaacctattcaagctgcaatttggcattgtttaaatcattatgcttat
tcagatgcaatatttcttgcagaacgattatgtgcagaatttgattcagatgaaagcatc
tttttactggctacctgttattatcgatcgggtaaaccatctcaagcgtatacaattctg
agtggaaaaaaaatagtgtcagaaaaatgcaaatttttattagcccgttgctgtgttgat
cttcacaagttgtctgaagcggaaactgtgttaactggtaatgtaggtgatttaatatca
tcttcatcgtgttcatcatttatcgaaaccataatttctgattatggcgacagttctcca
tttgctttgcaactgataagtcacatttggtggcgttctgagagatcacatttagctgct
gaggcctgtcggaaggctctctatttaaatccttttttgtggcaatcattccaagactta
tgcgacagaggtgttaaacctgatcctgaacccactaaaatatttaaggtggacaattta
gacaactttaataaatgtctaggttcaaattctcatgtcaattcaacacctttatcaaca
tataatctttcatatgaatcagtaaatacatttaatagtagcacaccagctcaaaaaatg
gtcaacatgtctgtacctagtagtaatagttcaatatccagtggtatacagccatttaca
ccggatatgaataatgctaaagcaatatttgttcgaccaatagggagaaaagtaaaagtg
attaatgaaaatgcttacagcccattgacaccaagttttggagtattccctctagaaaat
tcagataacttgtctgtttgttcgtcccaatcaatggttttagttccttcagctacatta
aatgaaactaatgatcagaaattcatatcaaaaagaagttctaaaccagtatttagtcag
tcagggaatacaagtaatattaacaatttgggaactcaacaaataactatgccttcaagt
ccaatgtcacatgttgtaagacgtagtagtcgaataatcaccaacaattgttcggttaag
gaaaatactaagagtccaaataaaaaatttgctagcccaaaatcagccacacgtaaaata
aaaagtggattgatacccaaaaagtcagtttttgctgatataactgaaagacatccaaaa
gagcgtggagtagttgaagtagaaacattgacacttgctcaacaagctcttaatttacaa
aaaaaaactacagaaggacttttgtcattacttagagatattggaattgcgtatttgcaa
ttgtcaaaatttaattgtaaaaaggcaattcaactatttcaaagtttaccgccacgacag
tataaaactggttttgtattgtcaatgattggcaaagcatattgtgaacagtctgattat
ttacaatcaataaaatattttagcgaagtgaaagagcatgaaccatatagggatacatta
atggaactttatagtacatctttatggcatcaacagaaagaggttgctttgtctgctcta
gcacaagacatgactgctttagatagaaattcttcatctacatggtgtgttgttggtaat
tgcttttccttgcaaaaagaacaccaaactgcaataaaatattttcaaagagctatacaa
gtgaatccagattttccatatgcatatgcacttttaggtaatgagtatttagtcactgaa
gaattggaaaaagctattacttgtttccagaaagctgtcaaattagatccaagacattac
aaatcttggtatggaattggtgctatttatcaaaaacaggaacggtatgaattagctgaa
atgcattataagcgagctcttagaataaatcatagtagcgctttaatcatgtgtcatatt
gctgttgtacaaaatagtatggacaaacctgaccaagcgttacatactttacatattgct
ttaacattagaacctaaacatccaatgtgtaaatatcaacgagcacaaatttattctaaa
ctcggtaaattaccagaagcactgtatgagttggaagaattgaaagaaattgtgccaaag
gaatctctagtctattttttaactggaaaagtacataaaaaactaggcaacatacacttg
gcattaatgaactttaatagagcaactgacttagatccaaaaggggccagtaatcaaatt
aaagaagcaatagatccgacaaataaccaatccccattggatgattcagatgacccttga

DBGET integrated database retrieval system