KEGG   Acyrthosiphon pisum (pea aphid): 100167783Help
Entry
100167783         CDS       T01076                                 

Definition
serine/threonine-protein kinase Doa-like
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 472 aa AA seqDB search
MPRISRRANSSSYEPPKSISRSRSRSRRKRRHEEGDEYNSSYSNERCNRSRMHDQGTSAE
RRYKRSHRRSPGSTNHQRRRLRRHPSPGSGDEKMHHRHHRHKERSHSKQRARSPVIVDDE
EGHLIYKNGDNLADRYQIIQTLGEGTFGKVVSAKCLKNRDEIAAVKIIKNVEKYREAARL
EINALEKLNAKDPESKNLCVRMIDNFEFGGHVCIGFELLGLSVFDFLKENNYQPYTVDQV
RHISYQLCYAVRFLHRNKLTHTDLKPENILFVKSEYDTQYNQKKKRAYKMIKDTEVRLID
FGSATFDDEHHSTVVSTRHYRAPEVILELGWAQPCDVWSIGCIIFELYLGITLFQTHDNR
EHLAMMERILGSIPYKMARRSKTKYFYHSKLDWDQSSSAGRYVRENCKPLKRYMSSEEED
HRLLFDLISQLLKYEPTQRMTMEEALDHQFFYKLPAHQRLHDKEERSHSLSR
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgccaagaatatctagaagagctaattcgagttcatatgaaccaccaaagtcaatttcc
agatcccgtagtcgatcgagacgtaaacgtcgtcatgaagaaggagatgaatataactca
tcttacagtaatgaacgttgtaatcgttcacgaatgcatgatcaaggaacaagtgcagaa
cgtcgatacaagcgcagtcatcgtaggtctcctggttcaaccaatcatcaacgtcgtaga
cttaggcgccatccatcacctggaagcggagatgaaaagatgcatcatagacaccataga
cataaagaacggtcacactcaaagcagcgagcaagaagtccagtcattgtggatgacgaa
gagggacatctgatatacaaaaatggagacaatctggccgatagatatcaaatcatccaa
acccttggagaaggtacttttggaaaggtagtgagtgccaaatgtctgaaaaatcgtgat
gaaattgctgcggtcaaaataataaaaaatgttgaaaaataccgagaagccgctcgttta
gaaattaatgccttagaaaaactaaatgcaaaggatccagaaagtaaaaatctttgtgtt
cgaatgattgataacttcgaatttggcggacatgtatgtattggatttgaattgttggga
ctaagtgtttttgactttttgaaagaaaataactatcaaccatatacagttgaccaggta
cggcatatatcttatcaattatgttatgctgtcagatttttacatcgcaataaattgaca
catactgatctgaaaccagaaaatatactttttgtcaaatctgaatatgatacacaatat
aatcaaaaaaagaagcgtgcgtataaaatgatcaaggataccgaagtacgattgattgat
tttggtagtgccacatttgacgatgaacaccatagtacagtcgtatcaacaagacattat
agagcacctgaagttattttggaacttggttgggctcaaccatgtgatgtatggtctatc
ggatgtattatttttgaactttatttgggcatcacattattccaaacacatgacaatcgt
gaacacctggcaatgatggagcgaattcttggctcaataccttacaagatggccagaaga
agtaaaacaaaatatttctatcatagcaaattagattgggaccaatccagttctgctgga
cgatatgttagagaaaattgcaaacccttaaagagatacatgagctctgaagaggaagac
caccggctattgttcgatttgatctctcaattgctcaaatacgagccaactcaacgcatg
accatggaggaagctttagaccaccaattcttttataaactacccgctcaccagagactt
catgacaaagaagaaagatcacattcactgtccagatga

DBGET integrated database retrieval system