KEGG   Acyrthosiphon pisum (pea aphid): 100167783Help
Entry
100167783         CDS       T01076                                 

Definition
dual specificity protein kinase CLK2
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100167783
Protein kinases [BR:api01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   100167783
Spliceosome [BR:api03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100167783
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 472 aa AA seqDB search
MPRISRRANSSSYEPPKSISRSRSRSRRKRRHEEGDEYNSSYSNERCNRSRMHDQGTSAE
RRYKRSHRRSPGSTNHQRRRLRRHPSPGSGDEKMHHRHHRHKERSHSKQRARSPVIVDDE
EGHLIYKNGDNLADRYQIIQTLGEGTFGKVVSAKCLKNRDEIAAVKIIKNVEKYREAARL
EINALEKLNAKDPESKNLCVRMIDNFEFGGHVCIGFELLGLSVFDFLKENNYQPYTVDQV
RHISYQLCYAVRFLHRNKLTHTDLKPENILFVKSEYDTQYNQKKKRAYKMIKDTEVRLID
FGSATFDDEHHSTVVSTRHYRAPEVILELGWAQPCDVWSIGCIIFELYLGITLFQTHDNR
EHLAMMERILGSIPYKMARRSKTKYFYHSKLDWDQSSSAGRYVRENCKPLKRYMSSEEED
HRLLFDLISQLLKYEPTQRMTMEEALDHQFFYKLPAHQRLHDKEERSHSLSR
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgccaagaatatctagaagagctaattcgagttcatatgaaccaccaaagtcaatttcc
agatcccgtagtcgatcgagacgtaaacgtcgtcatgaagaaggagatgaatataactca
tcttacagtaatgaacgttgtaatcgttcacgaatgcatgatcaaggaacaagtgcagaa
cgtcgatacaagcgcagtcatcgtaggtctcctggttcaaccaatcatcaacgtcgtaga
cttaggcgccatccatcacctggaagcggagatgaaaagatgcatcatagacaccataga
cataaagaacggtcacactcaaagcagcgagcaagaagtccagtcattgtggatgacgaa
gagggacatctgatatacaaaaatggagacaatctggccgatagatatcaaatcatccaa
acccttggagaaggtacttttggaaaggtagtgagtgccaaatgtctgaaaaatcgtgat
gaaattgctgcggtcaaaataataaaaaatgttgaaaaataccgagaagccgctcgttta
gaaattaatgccttagaaaaactaaatgcaaaggatccagaaagtaaaaatctttgtgtt
cgaatgattgataacttcgaatttggcggacatgtatgtattggatttgaattgttggga
ctaagtgtttttgactttttgaaagaaaataactatcaaccatatacagttgaccaggta
cggcatatatcttatcaattatgttatgctgtcagatttttacatcgcaataaattgaca
catactgatctgaaaccagaaaatatactttttgtcaaatctgaatatgatacacaatat
aatcaaaaaaagaagcgtgcgtataaaatgatcaaggataccgaagtacgattgattgat
tttggtagtgccacatttgacgatgaacaccatagtacagtcgtatcaacaagacattat
agagcacctgaagttattttggaacttggttgggctcaaccatgtgatgtatggtctatc
ggatgtattatttttgaactttatttgggcatcacattattccaaacacatgacaatcgt
gaacacctggcaatgatggagcgaattcttggctcaataccttacaagatggccagaaga
agtaaaacaaaatatttctatcatagcaaattagattgggaccaatccagttctgctgga
cgatatgttagagaaaattgcaaacccttaaagagatacatgagctctgaagaggaagac
caccggctattgttcgatttgatctctcaattgctcaaatacgagccaactcaacgcatg
accatggaggaagctttagaccaccaattcttttataaactacccgctcaccagagactt
catgacaaagaagaaagatcacattcactgtccagatga

DBGET integrated database retrieval system