KEGG   Acyrthosiphon pisum (pea aphid): 100167876Help
Entry
100167876         CDS       T01076                                 

Definition
histone deacetylase 4-like
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100167876
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1055 aa AA seqDB search
MSDDHSEPNSKITDNIKSIRSIEISSAFTQLSQKTEMTRESIVSSYNTEDALGDRPLELV
QPTNHVHEHTIHHQILELKKQQQLQQQYLLEQFQAQQQQLAEQHEQQLRQHLKDLWEKKR
ELEEKEQREKKEEEKLETIKKKEKHEQSAIASSEVKQILQGFLLSKKHREAASSSSIQSQ
QSYHSWGILQSQQSEPNVMPSSLSPSSSGSNITPYRFVGRYEDDFPLRKTASEPNLLKIR
LKQRMFDRRNNPIARPKERFGNRVSKLAIETSPSGSTPGSGPNSPPILIPNCRNSPSTGA
TTPIKEEGEISFGHMSNNKSDQSSSVADISALYTSPSMPNISLGRPPSNSDGSKLSSVSE
AEVRAAFTARLGAPLTGQMLSSTLPYYPTLPVMDTSQSFIQKQMRSLESRQTTTIPSFHP
APITDTQVAHARLNKAGHRPLGRTQSAPLPLGHPMLNSTVPGQQLSVHYEDYELPLQQLS
THYLKQQIRHTVLTRAGSRAHLANNSSLINEDQEDNAKVIDLTGGPRTSTDNGLKNKSQS
FLQQQRDLMMRQTSQSNDISLLANRNTHVTLPLVRTYSSPLDATVSTGGINSDTSTSSSS
PYLSSTSLNSSGTKLSASPHRPNTGLAFDSLMLKHACKCGNNAIHPEHSGRLQSVWARLI
ETGLARRCDKLRPRKATIEELQTCHTEPHTLLFGTNLASRQKMDSSKLAELPVKALVRLP
CGGLGVDSDTTWNELHTAPAARMAVGCVIDLAFKAALGDIKNGFAIVRPPGHHAEANQAM
GFCFFNSIAVACRLLQQRQAVRRILIVDWDVHHGNGTQQIFYDDRSVLYLSIHRHDEGNF
FPGTGAPGECGAGSGLGYNVNIAWSGGLQPPLGDAEYLAAFRTVVMPIARDYAPEIILVS
AGFDAASGHPAPLGGYNVTPACFAYMTQQLMQIADGKVILSLEGGYDLTAICDSAEECVR
ALLEDDVTPIVQSELHRTPCQNAIKTLQKTIAIQLPHWPVLKKLAHTVSCSAVEATLCEE
NETVSAMASLSMTRHRIQSSEPSEEPMEEDCEDDK
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatgatcattctgaaccaaacagtaagataacagacaacatcaagtcaattcgt
agtatagaaatcagttctgcgttcacgcaactatcgcaaaaaacagaaatgactcgtgaa
tcaatagtaagcagttacaatactgaagatgcattgggggacaggccattggaattagtt
caacctactaatcatgtccacgaacacacaatacatcatcaaatattggagttaaaaaag
caacaacaacttcaacaacaatatttattggaacaattccaagctcaacaacaacagtta
gccgagcaacacgaacaacaactccggcaacatcttaaagatttatgggaaaaaaaacgg
gaacttgaagaaaaagaacagcgtgaaaaaaaggaagaagaaaaattggaaaccataaaa
aaaaaagaaaaacatgaacaaagtgctattgcgtcatccgaagttaaacaaattttacag
gggtttctgctgagtaaaaaacatcgagaagcagcatcaagcagctctatacaatcccaa
caatcataccatagttggggtatcttacaatctcagcagtcggaaccaaacgtaatgcct
agtagtttaagtccatcatctagtgggtcaaatattacaccgtatagatttgttgggcgg
tacgaagatgattttcctcttagaaaaacagcgtccgaaccgaatttgctcaaaatcaga
ttgaaacagcgcatgttcgacagacgtaacaatccaatcgcacggcccaaagaaagattc
ggcaacagagtgtctaagctcgcaatagagacatcgccgtcgggtagcacccccggttct
ggacctaattctcctcctatactcataccaaattgtcgaaattcaccttcaactggagcc
acaactccaattaaagaagaaggagaaatttcatttggacatatgtctaataataaatca
gaccaaagcagtagtgttgctgatatatctgcattatatacaagtccttcaatgcctaat
atatcactaggtagaccaccatcaaattcggacggatcaaaattatcgtctgtttcggaa
gctgaagtccgtgctgcgtttactgcaagattaggtgcaccacttactggtcaaatgttg
tcaagtacattgccatattatcctacacttccagtaatggatacatctcaaagtttcatt
caaaaacaaatgcgaagtctcgagtccagacaaactactactattccatcatttcatcct
gcacctattactgacactcaagtggcacatgctaggttgaataaagctgggcacagacca
ctgggtcgtacgcagtcagcaccgctacctcttgggcatccaatgttgaacagcactgta
ccaggtcaacaactaagtgttcattatgaagattacgaattaccacttcagcaacttagc
acacattatttgaaacaacaaattcgtcataccgttttgactcgagctggaagtcgggct
catttggctaataacagtagtttaattaatgaagaccaagaagataatgcaaaggtgatt
gatttgactggtggtccaagaacatccacagataatggtttgaaaaataaaagtcaatca
tttttacaacaacaacgtgacctaatgatgcgacaaacatctcaatccaatgatatttca
cttttagcaaatcggaatacacatgttactcttcctttagttagaacatattccagtcct
ttagatgctaccgtaagtacaggaggcattaactctgacacatctacatcatcatcatca
ccatacctttcatctactagccttaattcttctggcactaaactatcagcaagtccacac
cggcctaatactggtctagcatttgacagtttgatgttgaaacatgcttgcaaatgtggc
aacaacgctatacatccagaacatagtggacggcttcaaagtgtttgggctcgattgatt
gaaacaggattagctagacgatgtgataagttgagaccacgcaaagctacaatcgaagaa
ttacagacatgccatactgaaccgcacactcttttatttggtacaaaccttgcgagtcgt
caaaaaatggatagttctaaattagcagaattgccagtaaaagcattggtacgattgcct
tgcggtggattaggtgtagattctgacactacatggaacgaattgcatacagcaccagct
gctcgtatggctgttggttgtgttattgatttggcttttaaagctgccctgggtgatata
aaaaatggctttgctattgtacgtccacctggtcatcatgcggaagctaatcaagctatg
ggattttgtttttttaattcaattgctgttgcttgtcgtctgttacaacaaaggcaagcc
gtacgacgtatacttattgttgattgggatgttcaccatggtaacggtacacaacaaatt
ttctatgacgatagaagtgttctatatttatctattcatcgacatgatgaaggtaacttc
tttccaggaactggtgcacctggtgagtgtggagctggcagtggtctaggatacaatgtg
aatattgcatggagtggtggtctacaacctccactaggtgatgctgagtatttagcagct
tttcgaacagtagtaatgcctattgctcgggattatgctccagaaatcattttggtatcc
gctggttttgatgcggcttcaggtcatccagctccattgggtggttataatgtaacccct
gcttgctttgcttacatgacacaacagttaatgcaaattgcagatggaaaggtaatttta
tcattagaaggaggatatgatctgactgcaatatgtgacagtgcagaagaatgtgtacgt
gcactgcttgaagatgacgtaacaccaattgtacagtctgagcttcatcggaccccttgt
caaaacgccataaaaacattacaaaaaaccatcgcaattcagttgcctcactggcctgtg
ttaaaaaaactagcacacacagtatcgtgcagtgctgtggaagctactttatgtgaagaa
aacgaaacagttagtgctatggcttcattatcaatgaccaggcatagaattcaaagttca
gaacctagtgaagaaccaatggaagaagactgcgaggatgataaatag

DBGET integrated database retrieval system