KEGG   Acyrthosiphon pisum (pea aphid): 100167887Help
Entry
100167887         CDS       T01076                                 

Definition
ubiquitin carboxyl-terminal hydrolase 43-like
Orthology
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.1.2.15]
Organism
api  Acyrthosiphon pisum (pea aphid)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 827 aa AA seqDB search
MDEISLLKKRTSAEALHNMTRNEDTNPPTSKLKRSFSLKRDLIRNKHVKSGDVEDARLKL
SMLRKPSSWNKVLGKMLQKMSYLGLQQDKSNLCSKYDAYVSRSSTDIYNDNNYQTPKILS
GDKVPGVVGLRNQGNTCFINAVLQCLSHTDVLARYFVMDQYKMDLTRRNKLNSKKYGTRG
EMTEQLALLLKSIWLCKYDPDMSNQFKTIVDKYGTQYRGNNQHDAQEFLLWLLDKVHEDL
NIATKKKYKTIRNTFGRPDEQVAAETLANHIRCNESFIHDVFQAQFKSSLTCPRCMRQSN
TFDPFLCISIPVPQCYSMPVFITVIYTSQQPRDVKLGLSLPVDSSIAEFRELLWSYTGIF
QEHMLITEITDIGFNRTFCDSMPASMIKESDPLYCLELPKLNDCSNESGPYLLLCWVNIL
VVEDQCSRFGSAYTMQICRETSYKDLQKLLLKEMAVMLHDDILTTDQEIPLFGIRLADAS
DLPQYLDPTVELPLFTDPIDQALAMSGDQPHVKLILEWNLHAKEATIADHCDQVEEHASV
KQLKLNSEKGTSITLEQCFDLYTKEEVLGPENAWHCPQCNLKQEVVKKLGLWTLPDILVV
HLKRFRQSLSLPSSRQHNNRQPTKLSVLVDFPLFSFDMTPHLAIGRDVRVPLKPLASRRL
SSIQDRNLYDLYAVCNHHGSDPHSGHYTAFCKNPYDKQWYSFDDTKVTPIPDTSLVTTSA
YMLFYQRRDMILNNSDHWATRLHAHISNSHSVGQIVDNIEHNNDDIAELSDSPSSHTISR
SSTVENDMVFSRPSSPMVNGRRPSDLCLDDTEKNFKKLLHNAKESCI
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atggacgaaatatcgttgctgaagaaacgcacttcagctgaagcgctgcacaacatgact
cgcaatgaagacactaacccaccaacttccaaactaaaacgatctttctcacttaagcgt
gacctgatacgcaacaaacatgtgaagtctggcgatgtagaggatgccagactaaagttg
tcgatgctgagaaaaccgtcatcatggaacaaggtacttgggaaaatgttgcagaaaatg
tcatacctcggtttacaacaagacaagagcaatctatgttccaagtatgatgcttatgtc
tcacgctcgtcaacagacatctacaacgataacaactaccaaactccaaaaattttaagc
ggtgacaaagttccgggtgtggttggtctacgtaaccaaggaaatacatgtttcataaat
gctgtattacagtgcttaagtcatacagatgttctagccagatattttgttatggatcaa
tacaaaatggaccttactcgaagaaataagttgaactcaaaaaaatatggtacacgcgga
gagatgactgaacagctggcattattattgaaatctatatggctatgcaaatatgaccca
gacatgtcaaatcaatttaaaacaattgtagacaaatatggtacccaatatcgaggaaat
aatcagcatgacgcacaagaattcttattatggcttttggataaggttcatgaagattta
aacatagctacaaaaaaaaaatataaaacaattagaaacacatttgggaggcctgatgag
caagtagcagctgagacacttgctaatcatatacgttgcaatgagtcctttatacatgat
gtatttcaagcccaatttaaatcttcacttacatgtccgcgctgcatgcgtcaatccaat
acattcgatccatttttgtgtatatcaataccagtaccacaatgttattcaatgcccgtt
tttattactgttatttatacttcccagcaaccaagagatgttaaacttggattgtctctt
ccagttgatagtagtatagctgaatttcgagagttactatggtcttatactggtatattt
caagagcatatgttaattactgaaataactgatatcggttttaatcgaacattttgtgat
tctatgccagcatctatgataaaagaatcagatcccttatactgtttagaactcccaaaa
ttgaatgattgcagtaacgagagtggaccttacttattactgtgttgggttaatattctt
gttgttgaagatcaatgttcaagatttggaagtgcttataccatgcaaatatgtcgtgaa
acatcctataaggaccttcaaaaacttttattgaaagaaatggcagtgatgttacatgat
gatatattaacaactgatcaagaaataccattatttggtatacgattagctgatgcaagt
gatttacctcaatatttagatccaacagttgaattacctctttttactgatccaattgat
caagcattagctatgtctggggatcaacctcatgtaaaattaattcttgagtggaatctc
catgctaaggaagcaacgattgctgatcattgtgatcaagttgaagagcatgccagtgta
aaacagctaaaattaaattctgaaaaggggacatccattacgcttgaacagtgttttgat
ctgtatacaaaagaagaggtattaggtccagaaaatgcatggcattgtccacaatgtaat
cttaaacaagaagttgtgaaaaagcttggcttatggactttacctgatattttggttgtt
catctaaaacgatttagacaatctctttcactaccgtcatcacgacagcacaataacagg
caaccaacaaaactttcagtacttgtagatttccctttgtttagttttgacatgacccca
catttagctataggtcgggatgttagggtaccactgaagcctctagcttctcgtcggtta
tcttctatacaggatcgtaacctatatgatctttatgctgtatgcaatcatcacggatca
gatcctcatagtggacattatactgcgttttgcaaaaatccatatgataaacaatggtac
agttttgatgatactaaagttactccaatacctgatacttctctggtaacgacatcagca
tacatgttgttttaccaacgacgagatatgattctcaataattctgaccattgggccaca
cggttacatgcacacatatcaaatagccattcggttggacaaatagttgataatatagag
cacaataacgatgatattgcagagttaagtgattcaccatcaagtcataccatttccagg
tcatcgacagttgaaaatgatatggtgttttcgagaccgagttcacctatggtaaatggt
agaaggccgtctgatctttgtcttgatgatactgaaaaaaatttcaagaaacttttacat
aatgctaaagaatcgtgtatttaa

DBGET integrated database retrieval system