KEGG   Acyrthosiphon pisum (pea aphid): 100167890Help
Entry
100167890         CDS       T01076                                 

Definition
uncharacterized LOC100167890
Organism
api  Acyrthosiphon pisum (pea aphid)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1125 aa AA seqDB search
MGLCLEYPISQIKEHEQEIDKLLPDVKNISPLVKAARILWKKWIVLKIVFKIPKLDRPKE
VNIPDDVIQPPILFSQTQTNSVPYHFGNPAVPNQLSKISCVQSQGNGQTNSVDSISKIIN
HQKINRDKNKTVLEWKKQCDHQPFKKNKVISPAMVNYSINSVLNPKQSLTSTFKTRIIHQ
DIPTIESSTLSKNIKWSDITENNLTVYELPTDSSEKINSANIEVIETEPIVYYPIEEIIT
TNQTWNLPPPTIVDLCNGSTLHSMLKTVPPCLPNDFISNTSDETSQCSFSYDTTTTWCVM
RPENVMYDAQHPSIQEQLAFLPIDITLKKSTKTQLDNIPNTNVEKTESNKKYKVVQPLDE
DMHKKYKVVQPLDEDMHKKYKGVQPLSEDMHKKYKVGQPLNEDKHKKYKGVQPLDEDMHK
KYKVVEPLGEDKHKKYKVGQPLDEDMHRKYKVVQTLGEDIHKKYKVGQPPDEDMHKKYKV
GQPLDEDMHKKYKVVQPLDEDMRKKLFKQCEENVQQLIDKGILNVCKTARQNYVDQSPIK
ILQSFFNKKLVKSTNVAPENKSNQHVLPNLIKRIKVISSCYRKQPSKIIEINNLVKSNSQ
ISKNDIFRIKEDQKTEITDTTSVALMLQNEQLSTIPQTLNLNKMFNKKLLKLNTKNKFAF
KILNGMIKHNSSMPKYFILQLPSDTKIITHNPSYELELHKKLIPSVQNILCAELKRGLDK
GIIKVYKQKIVMKYDETKAPESVTLDSILKENIVLSGNSIEIPQVKKQFKRKMPLPPLHN
TKNKKIRESRNQANDNTVFKKPMPPVINKNSFQRINTSVTNQVQEPKISSIALINTNANE
FRQKPSTSRQNIPSTAFLKLDLNNFRSEPSTSSCLKPDIDPSKIKLNELSENPSNQLITN
ITSLKTNANEIRQKPLMKCLPFNKVDNILITELEQNAKLLASTLSMDSTYVLPSTEDNSE
LIDPIVQNFKNSICQKKSMIRANLVDDPIVRDYIERTQSKSVDTKRKCKLPESMMSLPIE
VLNLIPDNQREIKYVIDFYHAMATVIVKVLDLYVKKSCKQGRIKNDDDFKYLAKKLNANI
LFKELQVKKVEDLRISDSVKQKVEQYIKKYMLKYGKLYRRKSTDQ
NT seq 3378 nt NT seq  +upstreamnt  +downstreamnt
atgggcctttgtttagagtatccaatatcacaaattaaagaacatgaacaagaaattgat
aaattgttaccagatgtaaaaaatatatcaccattagttaaagcggcaagaattttatgg
aaaaaatggatagttctgaaaattgtttttaaaataccaaaattagatcgtccaaaagaa
gtgaacattcctgatgacgttatccaaccaccaatactattttcacaaacacaaacaaat
tctgttccatatcattttggaaatcctgcagttcctaatcaactttctaaaataagttgt
gtacaaagccaaggtaatggtcagaccaattctgtggattcaataagtaaaataattaat
catcagaaaattaatcgagacaagaacaaaactgttttggaatggaaaaaacaatgtgat
catcagccttttaaaaaaaataaggttattagtcctgccatggtaaattattcaattaat
tcagttttaaatcctaagcaaagcttaacatctacatttaaaacgagaattatacaccaa
gatattccaacgattgaaagcagcactcttagtaagaatataaaatggagtgatatcact
gaaaataacttaacggtctatgaacttccaactgattcttctgaaaaaattaattctgct
aatatcgaagtaattgaaactgaaccaatagtatattaccctattgaagaaattataact
acaaaccaaacatggaatttaccgcctccaaccattgttgatctttgtaatggatctact
ctgcattctatgctaaaaacagttcctccatgtttaccaaatgactttatttcaaatacg
tctgatgaaactagccaatgttcattttcttatgatactactactacttggtgtgtaatg
cgtccggaaaatgtgatgtatgatgctcaacatcctagcatccaagaacaattggctttc
ctaccgattgacataacactaaaaaaatcgactaaaacacaattagataatataccaaat
actaatgtagaaaaaacagaatccaataaaaaatataaagtggtacagccactagatgaa
gatatgcataaaaaatacaaagtggtacagccactagatgaagatatgcataaaaaatac
aaaggggtacagccactaagtgaagatatgcataaaaaatacaaagtgggacagccacta
aatgaagataagcataaaaaatacaaaggggtacagccactagatgaagatatgcataaa
aaatacaaagtggtagagccactaggtgaagataaacataaaaaatacaaagtgggacag
ccactagatgaagatatgcatagaaaatacaaagtggtacagacactaggtgaagatata
cataaaaaatacaaagtgggacagccaccagacgaagatatgcataaaaaatacaaagtg
ggacagccactagatgaagatatgcataaaaaatacaaagtggtacagccactagatgaa
gatatgcgtaaaaaattatttaaacaatgtgaagaaaatgtgcaacaattaattgataaa
ggaatattgaatgtttgtaaaacagctaggcaaaattatgtagatcagtctccaattaaa
atacttcaatcattttttaataaaaaactagtgaaatcaacaaatgtggcacctgaaaac
aaatcaaatcaacatgttttgccgaacttaatcaaacgcataaaagtaattagtagttgt
tatcgaaaacaaccatccaaaataattgaaataaataatttagtaaaatcaaattcacaa
ataagtaaaaatgacatatttagaattaaggaagaccaaaagactgaaataactgataca
acttcggtagctttaatgttacaaaatgaacaactaagtactattcctcaaacacttaac
ttgaataagatgttcaataagaaattgttgaaattaaatacaaaaaataaatttgcgttt
aaaattttgaatggtatgataaaacataattcaagcatgcccaaatattttattctccaa
ttaccatcagataccaaaataataactcataacccttcatatgaattagaacttcacaaa
aaattaattccatcagtacaaaatattttgtgtgctgaattaaagaggggacttgataaa
ggcatcataaaagtgtacaaacaaaaaatagtaatgaaatatgatgaaacaaaggcccca
gaatcagttactttagattcaatattaaaagaaaatattgttttatctggtaacagtata
gaaatacctcaagttaaaaaacaatttaaaagaaaaatgcctttgccacctttacacaac
acaaaaaataaaaagattagagaatccagaaatcaagctaatgataatacagttttcaaa
aaaccaatgcctcctgttattaataaaaacagctttcaacgtattaatacttcagttact
aaccaagtgcaagaacctaaaatatcaagtattgcgctgattaatacaaatgcaaatgaa
tttagacagaaacctagtacatcaagacaaaatatacctagtactgctttcttaaaatta
gatttgaacaattttagatcggaacctagtacatcaagttgtctaaaaccagatattgat
ccatcaaaaataaaactaaatgaattaagtgaaaacccatctaatcaattaatcacaaat
attacatcgttaaaaacaaatgcaaatgaaattagacaaaaacctctaatgaagtgttta
ccattcaataaagtagacaacattttaataactgaactagaacagaatgctaaactttta
gcctcaactttaagtatggattccacctatgtcttaccatcaacagaagataatagtgaa
ctaattgacccaatcgtacagaacttcaagaattctatttgtcaaaagaaatctatgata
cgtgcaaatcttgttgatgatccaattgtgagggattatatagaacgtactcaatcaaaa
tcggttgatacaaaacgtaaatgtaagctaccagaaagtatgatgtctttacccattgag
gttcttaaccttataccagacaatcaaagagaaatcaagtatgttattgatttttatcac
gcaatggctacagttattgtcaaagtattagacttgtatgtgaagaagagttgcaaacaa
gggcgtataaagaatgatgatgatttcaaatatttagctaaaaagctcaatgccaatatt
ttattcaaagaacttcaagttaaaaaggtagaagatttaagaattagtgatagtgtcaag
caaaaagtcgaacagtacataaaaaaatatatgttaaagtatggaaaactgtacagaaga
aaaagtactgatcaatga

DBGET integrated database retrieval system