KEGG   Acyrthosiphon pisum (pea aphid): 100168040Help
Entry
100168040         CDS       T01076                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:api00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100168040
   04142 Lysosome
    100168040
Exosome [BR:api04147]
 Exosomal proteins
  Proteins found in most exosomes
   100168040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1700 aa AA seqDB search
MAQILPIKFQEHLQLTNVGINQSNISFNTLTMESDKYICVREKTGDVAQVVIVDMADPQN
PIRRPISADSAIMNPASKVIALKGKAGTEGTAASQKTLQIFNIEMKSKMKAHIMQDDVVF
WKWISPNTLALVTETSVFHWSMEGDSTPVKMFDRHSTLNGCQIINYRTDHKQQWLLLIGI
SAQQNRVVGAMQLYSVEKSCSQPIEGHAASFARFQMEGNREMSTLFCFAARTAAGGKLHI
VEVVQTPRGNQPFPKKQVEVFFPPEAQNDFPVAMQVSSKFDVIYLITKYGYIHLYDIETA
TCIYMNRISGDTIFVTAPHDATGGIIGVNRKGQVLSVSVEEDNIIPYINTVLQHPELALR
MAVRNNLSGAEELFVRKFNMLFQSAQYADAAKVAANAPKGILRTPSTIQKFQQVPTVANQ
SSPLLQYFGILLDQGKLNKYESLELCRPVLAQDKRQLLEKWLKEDKLECSEELGDLVKTA
DISLALSVYLRANIPPKVVQCFAETGQYQKIILYSQKISYVPDYIHLFRNVVLRTTPDHA
VEFAQMLLSDDAEPLANINQIVDIFIEQSMVQQCTKFLLEALKHNREAEGPLQTRLLEMN
LISAPQVADAILGNQMFTHYDRAHVAQLCEKAGLLQRALEHYTDLYDIKRAVVHTQLLNP
EWLIGYFGSLSVEDSLECLKAMLTNNIRQNLQICVKIATKYHEQLTTKALIDLFESFKSY
EGLFYFLGSIVNFSQDPEVHFKYISAACKTGQIKEVERICRESTCYNAERVKNFLKEAKL
TDQLPLIIVCDRFNFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVVGGLLDVDCSEDI
IKNLIQVVKGEFSTDELVEEVEKRNRLKLLSSWLELRVHDGSEEPATHNALAKIYIDSNN
NPERYLKENKFYDSRVVGKYCEKRDPHLACVAYERGKCDLELINVCNENSLFKSEARYLV
RRRNPELWLEVLNENNVYRRPLIDQVVQTALSETQDPEDISVTVKAFMTADLPNELIELL
EKIVFDNSLFSSHRNLQNLLILTAVKADRTRVMDYINRLDNYDAPDIASIAINNELFEEA
FAIFKKFNVNQSAIQVLIDNVKNLDRAYEFAERCNEPGVWSLLAKSQLQSMFVKEAIDSF
IKADDPSAYMDVVQTAHKTGSWEDLVRYLQMSRKKARESYIESELIYAYAKTNRLADLEE
FISGPNHADIQKIGDRCFEDKMYEPAKLLYNNVSNFARLAITLVHLKEYQGAVDSARKAN
STRTWKEVCFACVDNNEFRLAQMCGLHIVVHADELEDLINYYQDRGYFEELINLLEAALG
LERAHMGMFTELAILYSKYKPAKMKEHLELFWSRVNIPKVLRAAEQAHLWSELVFLYDKY
EEYDNAVLAMMNHPTEAWRESHFKDIITKVANLELYYKAIQFYLDYKPLLLNDLLLVLTP
RMDHTRGVAYFTKTNHLQLVKTYLRSVQSLNNKAINEALNNLLIDEEDYQGLRTSIDAFD
NFDTIALAQKLEKHELTEFRRIAAYLYKGNNRWKQSVELCKKDRLYKDAMEYAAESKNSE
VAEELVTWFLERGNYDCFAAALFQCYDLVHPDIVLELAWRHKIMDFAMPYLIQVTREYVS
KVDKLEEAESKRLEEHKEEDIKPMMIPEPQLMLTAGPSVMGNMYSPSYQGTVAPSQQPYV
PPSGAPYATSNTLPYQGYGM
NT seq 5103 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagatactacctatcaagttccaggaacacctacagcttacaaatgtgggcatc
aatcagtcaaacatcagttttaatacactcaccatggaatcagataaatatatctgtgtg
cgtgaaaagactggtgatgttgcacaagttgttattgttgatatggctgatccccaaaat
ccaataagacgtccaatatctgcagattcagccataatgaatccagccagcaaagtaatt
gcactgaaaggaaaagctggtactgaaggaacagctgcatctcaaaagaccttacagatt
tttaatattgagatgaagagtaaaatgaaagctcacattatgcaagatgatgtagttttt
tggaaatggatttctccaaatacattagctctcgttacagaaacatcggtttttcattgg
agtatggaaggagactctacacctgtaaaaatgtttgatcgtcattctacattgaatggg
tgtcaaattattaattatagaacggatcataaacaacaatggttattactcataggaatt
tcagctcaacaaaatcgtgttgttggagctatgcaattatattcagtagaaaagagttgt
tcacagcccattgaaggccatgctgcatcatttgcaagattccaaatggaaggaaataga
gaaatgtcaacattattttgttttgctgcacgtacagctgcaggaggaaagttgcacatt
gttgaagtggtacaaacaccaagaggcaatcaaccatttccaaaaaaacaagtggaagtt
ttctttcctccagaagcacaaaacgatttcccagttgcaatgcaagttagctcaaaattc
gatgtaatatatcttattactaagtatggctatattcatctatatgacattgaaacagct
acttgcatctatatgaaccgcattagtggagacacaatttttgtaactgcgccacatgat
gccactggtggtataattggggttaatcgtaaaggacaagtattatctgtcagtgttgaa
gaagacaacataataccgtacataaatacagtacttcaacatccagaactcgctttacgt
atggctgtacgaaataatttgtcaggcgcagaagaactttttgtacgcaaatttaacatg
ctcttccaaagtgcacaatatgcagatgctgctaaagtagcagctaatgcacctaaaggc
attctcaggacaccttctaccatacaaaaatttcaacaggttccaactgtcgcaaatcaa
tcatcccctctacttcaatactttggaatactactggaccagggcaagttgaataaatat
gaatctctggaattatgtcgtccagttcttgcacaagataaaaggcaattattagaaaag
tggctaaaagaagataaattggagtgctctgaagaattaggagacttagtaaaaactgca
gacatttctttagcattgtcagtttatctgcgtgcaaacattccaccaaaagttgttcaa
tgttttgctgagactggccagtatcagaaaattatactgtactcccaaaaaataagttat
gtaccagattatatacatttattcaggaatgtcgtcttacgtactactcctgatcatgct
gttgaatttgcccaaatgttactgtctgatgacgctgaacctcttgctaatattaaccaa
attgtggatatatttatcgagcaaagcatggttcaacaatgcactaaattccttctagaa
gcattgaagcataaccgcgaagccgaaggcccgttacaaacacgtttgcttgaaatgaat
ttaatatctgctccacaagttgctgatgctattcttggtaaccaaatgtttactcattac
gatcgtgctcatgttgcccaattgtgtgaaaaagctggacttttacaaagagctctggaa
cattatacagacttatatgatataaaaagagcagttgtacatacacaattattaaatcct
gaatggttaattggttactttggatccttgagtgttgaagattctttggaatgtttgaaa
gctatgctaactaataacataaggcaaaaccttcaaatttgtgttaagattgcaactaaa
taccatgaacaattgacaactaaggcgttgattgatttatttgagtcatttaaaagttat
gaaggattattttacttcttgggatccattgttaacttcagccaagatccagaagttcat
tttaaatacatttcagcagcttgcaaaactggacaaattaaagaagtggagcggatatgt
cgtgaatctacttgttacaatgcagaaagagttaagaatttcttgaaagaagcaaagctt
actgatcagttaccattaatcattgtgtgtgatcgatttaatttcgtacacgatcttgtg
ttatatttatatagaaataatttgcaaaaatatattgagatttatgtacaaaaagtgaac
ccatcacgtttaccagttgtagtcggtggactccttgatgtagattgttcagaagatata
atcaaaaatcttatacaagttgtgaaaggagaattctctactgatgaattggtagaagaa
gtagagaagcgtaaccgtcttaaactattgtcatcttggctagaattacgcgttcatgat
ggtagtgaagagcctgcaactcataatgcacttgctaagatttatattgacagcaacaac
aatccagaaagatatttgaaagagaacaagttttatgatagtcgcgtggttggcaagtat
tgtgaaaagcgtgatccacatttggcatgcgttgcttatgaacggggaaaatgtgatttg
gaattgataaatgtttgtaatgagaatagtcttttcaaatctgaagctagatatttggtt
agacgtcgtaatccagagttgtggctggaagtattgaatgaaaacaatgtctatcgtcgt
ccactcattgatcaagttgtgcaaacagctttatctgaaactcaagatcctgaagacata
tcagtaactgtaaaagcttttatgactgctgatttgcccaatgaactgattgaactatta
gaaaaaattgtatttgataattcattattcagctctcatagaaacttgcaaaatctattg
attttaacagcggttaaagccgaccgaactcgtgttatggattatattaatcgcttggac
aactatgatgctcctgatattgcatccattgctattaacaatgaattatttgaagaagct
tttgcaatatttaagaagtttaatgttaatcaatctgctattcaagtacttattgataat
gttaaaaatcttgatcgcgcctatgaatttgctgaacgttgtaatgagccaggtgtttgg
agcttattggcaaaatctcaattgcaaagtatgtttgtcaaagaagctattgactcgttc
attaaagctgatgatccaagtgcatacatggatgttgttcagactgcacacaaaacagga
agttgggaagatcttgtacgttacttgcaaatgtcgcgtaagaaggctcgtgaatcatat
attgaaagcgaattaatctacgcttatgccaaaacaaatcgtcttgcagatcttgaagaa
tttatttctggaccaaatcacgctgatattcaaaagatcggtgataggtgttttgaagac
aaaatgtatgaaccagctaagctgctgtataacaacgtctcaaactttgcacgattagct
attactcttgtacatcttaaagagtatcaaggtgctgtggacagtgcccgtaaagcaaat
agcacaagaacatggaaagaagtgtgttttgcatgtgttgataataacgagttcaggtta
gctcaaatgtgtggtctccacatagttgttcatgctgatgaattagaagacttgattaac
tactaccaggatcgtggttattttgaagaacttattaatcttctagaagcagcattggga
ttggaacgtgcacatatgggaatgtttacagaattggctattttatactccaaatataag
ccggctaagatgaaggagcatttagaactcttctggtctcgtgttaatatccctaaggtg
ttaagagcggctgaacaagcgcatttgtggtcagagttagtatttttatatgataaatat
gaagagtatgataatgcggtattagccatgatgaatcatccaactgaagcatggcgagag
agtcattttaaagacattattacaaaggttgctaatttagaattatattacaaagcaata
caattttatcttgattataaaccgcttctgctcaatgacttattgttggtgttgacacca
cgaatggatcacactagaggtgttgcctatttcactaagacaaatcatttgcaattagtc
aaaacctacctgcgttccgtgcaatctttgaataataaagctataaatgaagcactaaat
aatttactgatcgatgaggaagactaccaaggtctacgaacgtccattgatgcatttgat
aattttgatactattgcacttgcccaaaaacttgaaaaacacgaacttacagagtttagg
cgcatagctgcttacttgtacaagggaaataataggtggaagcagagtgttgaattatgc
aagaaagacagattatataaagatgctatggaatatgcggcagaatcaaaaaattcagaa
gtagctgaagaattggttacgtggttcttagagcgtggaaactatgattgttttgctgcc
gctttgtttcaatgttatgatcttgtgcacccagacattgtattggaactagcgtggagg
cataaaatcatggactttgctatgccttatcttattcaagtcactagagaatatgtttcc
aaggtagataaattagaagaagccgaatccaagcgattggaagaacacaaagaagaagat
atcaaaccaatgatgatacctgaaccacaactgatgttgacagctggtccatctgttatg
ggtaatatgtactcgccgtcctatcaaggaactgtagccccttcacaacaaccttatgta
cccccaagcggagccccttatgcaacttcaaatactttaccctatcagggctatggcatg
taa

DBGET integrated database retrieval system