KEGG   Acyrthosiphon pisum (pea aphid): 100168151Help
Entry
100168151         CDS       T01076                                 

Gene name
for, ACYPI006577
Definition
cGMP-dependent protein kinase foraging
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100168151 (for)
Protein kinases [BR:api01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   100168151 (for)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 923 aa AA seqDB search
MKICFVFYPGKATQVVPLVAATQEEDEDEDEDDDNDNVKAVVEDHDKNNNNNDKNNNNED
HEHDHDVVISKEPAPSDDMNSYEASWQECRLKWCLRSRSKERHDAVAGWTEDDEDDHGEG
SGGSRGRTQVVRRNPSEKRQACSSDSTGSSQEEQDAAAWAAASARRPKAKPLSRVQSVRH
DTAAHRYRTRQRVAAEILDEQRAEASAAAARDLCRSSAAKIKKSLSFRNPAPKKVATGGD
RLLRVVSDDDHFSHHHHHNNNNNDNRQPRRHHNKEKDHCHHHDDGDDQQQYHQQQQLLTV
DAGASFVATATETTVSPSTANATAGDSGSSGGQDNFAIPRPKLIVPVHTYGLRKRRTGNT
ISSNRTASDVNAASASSTVASSSGSSSTATASDTKKHHNSCPEGRVEVSRENKYLSTMTS
GKVFGELAILYNCKRTATIKAATDCKLWAIERQCFQTIMMRTGLIRQTEYTDFLKSVPIF
KDLPEETLIKISDVLEETFYNAGDYIIRQGARGDTFFIINKGKVKVTIKQSNNAEDKYIR
TLQKGDFFGEKALQGDDLRTANIIACDPDGVSCLVIDRETFNQLIAGLDEIRTRYKDDDV
LGRMSSTNKEFQNLKLSDLQVLATLGVGGFGRVELVQVNSDTSRSFALKQMKKSQIVETR
QQQHIMSEKEIMGEANCEFIVKLFKTFKDQKYLYMLMESCLGGELWTILRDKGHFDDSTT
RFYTGCVVEAFDYLHSRNIIYRDLKPENLLLDITGYVKLVDFGFAKKLHNGRKTWTFCGT
PEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGADPMKTYNIILKGIDAIEFPR
NITRNARVLIKKLCRDNPAERLTEVQKHKWFDGFNWEGLRNRTLTPPILPKVRSAIDTSN
FDNYPPDADSPPPDDNSGWDVNF
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctgtttcgtcttttacccgggaaaagctactcaggttgtacctttggtcgcg
gcgacacaggaagaggacgaggacgaggacgaggacgacgataacgataacgtcaaagcc
gtcgtcgaagaccacgacaaaaacaataacaacaacgacaaaaataacaataacgaagat
cacgaacacgaccacgacgtcgtcatctccaaagaaccggcgccgtccgacgacatgaac
tcgtacgaggcgagttggcaagagtgccggttgaagtggtgtctgcggtcgcgaagcaaa
gagcgtcacgatgctgtcgccggttggactgaagacgacgaagacgaccatggtgaaggc
agtggtggaagtcgaggcagaacgcaggtcgttcgcaggaatccgtcagaaaagcggcag
gcatgcagcagcgacagcacgggcagcagccaagaagaacaggacgccgcggcatgggcg
gccgcttcggcccgtcgacctaaggccaaaccactgagtcgcgtgcagagcgtccgccac
gacacggccgcacaccggtaccgaactcgtcagcgggtggccgctgaaattctggacgag
cagcgggccgaagcgtcggcggcggcagcgcgtgatctttgccggtcgtctgcggccaag
atcaagaaaagtctgtcgttccggaatccagcacccaaaaaggtggccaccggtggcgac
cgtctactccgggtcgtttccgatgacgatcacttcagccaccaccatcaccacaacaac
aataacaacgacaaccgtcaaccacgtcgccaccacaacaaggaaaaagatcattgtcat
caccacgatgacggtgatgatcaacaacaataccaccaacagcaacaactgttaaccgtg
gacgcgggtgcgtccttcgtcgccactgccactgaaaccaccgtatccccatcgaccgcg
aacgccactgcaggcgacagtggcagcagcggtggccaagacaatttcgccattcctagg
cccaaactcatagttcctgtacacacgtatggtctcagaaagcgcaggaccggtaacacg
atctcatcgaaccgaaccgccagcgatgtaaacgcagcttcagcttccagcaccgtcgcc
tcctcttccggcagctcgtcgaccgccaccgcctctgacacgaaaaaacatcacaactcg
tgtccagagggacgagtggaggtgagcagagaaaataaatatcttagtactatgacctcc
ggaaaagtgttcggagagttggctattttatacaactgcaagcgtactgccactattaaa
gctgctacggactgtaagctatgggcgatcgaacgacaatgcttccaaacaattatgatg
aggactggtctcataaggcaaacggaatataccgatttcctcaagagcgttccaatattc
aaagacctgccagaagaaacacttataaagatttcggacgttttggaagagacgttttac
aatgctggagactatataatcagacaaggtgcccggggagacacgttcttcataatcaac
aaaggaaaggttaaagtcaccataaaacaatcgaacaacgctgaagacaagtacatcaga
accctgcaaaagggtgactttttcggcgaaaaagcgttacaaggcgatgacttgcgtacc
gcgaacataatcgcatgcgaccccgacggcgtatcgtgtttggtcatagaccgggagaca
ttcaaccaactgattgccggactagacgagatacgcacaagatacaaagacgacgatgtc
ttgggacgaatgagctctacaaacaaggaattccaaaacctaaaactttccgacctacaa
gtcttagccactttgggcgtgggtggtttcggtcgtgtggaactcgtccaagtaaacagc
gacacatctagatcgtttgccctaaaacaaatgaaaaagagtcaaattgttgaaacgaga
caacaacagcacatcatgtcagaaaaagagatcatgggagaagccaactgtgaattcatt
gttaagttattcaagacgttcaaagaccaaaaatacttgtatatgctcatggagtcttgt
cttggtggagaattgtggactatactgagagacaaaggacattttgatgattctaccaca
cgtttctacaccggatgtgttgttgaagcattcgactacttacattctcgcaacataatt
tatagagatctgaaacctgaaaatctacttttagatatcactggttatgtgaaattggtc
gattttggttttgctaaaaaactacataacggaagaaaaacctggacattctgtggaaca
ccagaatatgttgcccctgaagtgattctcaacagaggtcatgatattagtgctgattac
tggtccttgggagtacttatgtttgaactacttaccggtacaccaccattcactggagca
gatcctatgaaaacttataacataattctaaaaggcattgatgcaatagaatttccaaga
aatataacaagaaatgctagagttttaattaagaaattatgcagagataatcctgctgaa
cggctaactgaagtacaaaaacacaagtggtttgatggtttcaattgggaaggactacgt
aatcgaaccctaactcctcctatcttgccaaaggtgcgaagtgctatagatacaagcaat
tttgacaattatccgcctgacgcagacagcccaccaccagatgataattcaggatgggat
gtaaatttctaa

DBGET integrated database retrieval system