KEGG   Acyrthosiphon pisum (pea aphid): 100168202Help
Entry
100168202         CDS       T01076                                 

Definition
protein disulfide-isomerase A6
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:api00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100168202
Enzymes [BR:api01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100168202
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 434 aa AA seqDB search
MNPLCYVLLAALANSAVAIYPSNSDVIELTDDNFNQVLQSVEIWVVEFYAPWCGHCQRLV
PEYSKAAKALKGIVKVAAIDADKYPSFAGRYGVQGFPTVKIFVDKNKPQDFTGDRTAVGI
TDEVTKAIKNAISANLQGVPYGSSKSSKKSSSGDDVVELTDSNFDKLVLNSDDIWLVEFF
APWCGHCKNLAPHWAAAASELKGKVKLGALDATVHSSKAQEFNIRGYPTIKFFPSGTSSS
SGAEEYTGGRTSSDIVSWAMQKHQENVPPPDIIEIVNEDTFKAGCSEHALCVVSVLPHIL
DCQASCRNEYLNTLRSLGDKFKQKLWGWLWAEAGKQPELESTLEIGGFGYPALAVLNVKK
MKYSILRGSFSEDGIKEFLRDLSYGRGTTAPVKGAALPEIQATEPWDGKDGELPTADDID
LSDVDLDDLPKEEL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgctgtgctacgttttgttagcggcccttgccaattccgcggtggccatatat
ccgtctaattcggacgtcattgaactcaccgatgacaatttcaatcaggtgctccaaagc
gtcgagatatgggtggtcgagttctacgccccgtggtgcggacactgccagcgacttgta
cccgaatactcgaaagccgcaaaagcccttaagggtatcgttaaagtggctgccatagat
gccgataagtatccgtctttcgcaggtcgttatggagtacaaggttttcctactgtaaaa
atttttgttgataaaaacaaaccacaagatttcaccggagatcgaacggctgtcggtatt
actgatgaagtcaccaaagccattaagaatgccattagcgctaatctccaaggtgtacct
tatggatcatctaaatcgtctaaaaaatcatcatctggtgacgacgttgttgaactgact
gattcaaatttcgataagcttgtattgaattctgatgatatttggttggttgaattcttt
gccccatggtgtggacattgtaaaaacttggctcctcattgggcagcagctgcttcagaa
ctcaaaggaaaagttaaactcggagcattagatgctactgtgcactcttcaaaagctcaa
gaattcaacattcgtggatatcccacaattaaatttttcccatctggcacatccagttca
agtggagctgaggaatatactggaggaagaacatcttcagacattgttagctgggcaatg
cagaaacatcaagaaaatgtaccaccaccagacattattgagattgtaaatgaagataca
ttcaaagctgggtgctcagagcatgctctgtgtgtagtctctgtactaccccacatttta
gattgccaggccagctgtcgtaatgagtacctgaatacattacgctcattaggagataaa
ttcaaacaaaaactttggggatggttgtgggccgaagcaggcaagcagccggaattagaa
tcaacactagaaatcggtggttttggatatcccgctttggctgtgctgaatgttaaaaaa
atgaagtattcaattttaagagggtcattttcagaagatggtattaaggaatttttaaga
gatttgtcttacggtcgtggtacaactgccccagtcaaaggcgctgcattaccagaaatt
caagcaaccgaaccttgggatggtaaagatggtgaattaccaactgccgatgatattgat
ttatctgatgttgacttagacgatcttcctaaagaagaattataa

DBGET integrated database retrieval system