KEGG   Acyrthosiphon pisum (pea aphid): 100168375Help
Entry
100168375         CDS       T01076                                 

Definition
sphingosine kinase 2-like
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100168375
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     100168375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 596 aa AA seqDB search
MDGNGLVAPPILEETFYALSRKQYTYKVSLTNEGLHLTKNGDDGTEKTDLIHIRDIIGCK
CMRNSGKSEHCACRPAKGGTVDATREGTAETNECRVRVPFVEAGDCSAYLSVYAFVLKNV
GAKNEKRDKMTVTLRFRNFSTYDENSQVAAKWKTAIKSLLQARCEDGTIVAPSDDHYLGN
HLLVIVNPKSGVGKSREIFQRKIVPILNMADVDYDLHITCMQNDARNLMRTSNIYKWGRG
VVVLGGDGLMFEVINGLMERSDWQRAFEYLTLAVIPGGSGNGMAKSISFETNEPYNPDPI
LISALNIVGGNRCPMDLVRVETLTQVVYSFLSIGWGFIADIDIESERIRMLGSPRFTIWS
IARLIGLRSYPARLSYSKINDLETETRMNNYARCTSGDFQEVADDEPVSIEFGMDPLEGF
AARERVESFSSIISRRTAFMSVNEAPSFSSIPDVIEGSEVWVRGPLSKLPPLSDPVPSDW
VVVEDEFVMIHASYLSHISEDVIIAPKSKLNDGVIWLLVIKNGISRTTFLQFLLGLSSGN
HLAVPNVEMIPVRAFRLEPLSQGSHLVVDGELLKHSPVQAEIMPGITNVYARQKFS
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atggacggaaacggactcgtcgccccacctatactcgaggaaacattttacgcactctcc
agaaagcagtacacgtacaaggtgtcgctgacgaacgaaggtctgcacctgaccaagaat
ggtgacgatggcaccgagaagactgacctgatacacattcgtgatataattggctgtaag
tgcatgcgaaatagtggcaagtctgaacactgcgcctgtcgtccggctaaagggggcaca
gttgatgccaccagagagggcacagcagaaaccaacgagtgtcgggtacgagtgccattt
gtggaggctggtgactgcagtgcgtacctaagtgtgtatgcatttgtgctgaagaatgtt
ggggctaagaacgagaagcgtgacaagatgaccgtcacactgaggttccgaaacttcagt
acttacgacgagaacagccaggttgcagccaaatggaaaacagccataaaatcattgctg
caggccagatgcgaggacgggaccattgttgcaccatcagatgaccattacctaggtaac
catttattagtaattgtgaacccaaaaagtggtgtcggaaaatcacgtgaaatatttcaa
cgtaaaatagtacctattttaaatatggctgatgttgactacgatttgcatattacatgc
atgcaaaatgatgctaggaacttgatgagaacgagtaacatctataaatggggccgtggt
gtggtagtacttggcggtgatggactcatgttcgaagtgattaacggtctcatggaacgg
tcagactggcagagggcctttgagtacctgaccctggccgtcatacccggtggttccggc
aatgggatggccaagtcgataagtttcgagaccaacgaaccctacaatccggatcccata
ctcatatcggcgctaaacatcgttggcggtaacaggtgtccaatggatctggttagagtc
gagactcttacacaagtcgtatactcttttttgtcgattggttggggttttattgctgac
attgatatagagagcgagagaattaggatgttaggtagccccaggtttactatttggagt
attgccagacttattggtctaagaagttatcccgcccggttgtcatattccaaaatcaac
gatctggaaactgagacgagaatgaacaattacgcgagatgcacgtcaggtgatttccaa
gaggtcgccgacgacgaaccagtgtcgatcgaatttggaatggacccgttagagggattt
gctgcacgcgagcgggtcgagagtttttcgtcgataatatccaggcgcacggcgttcatg
tctgtcaacgaagctccgagcttctcatctataccagatgtgatcgagggatccgaagtt
tgggtgcgcggacctctatctaaactacctccgctttctgatccagttccgtcggactgg
gtagttgttgaagacgagtttgtgatgatacatgcttcgtatctatctcacataagcgaa
gacgtaataatagcacccaaatcaaaattaaacgatggtgtaatttggctgttggttatc
aaaaatggcatatccaggacaacttttctacaatttttgttgggcctatcgtccggaaac
cacttggccgtacccaacgttgaaatgatccccgtgcgagcgttccggctcgaaccttta
tcacaaggcagccacctggttgttgatggtgaactgctgaagcacagtccagtacaagcg
gaaatcatgcccggcatcaccaatgtgtacgcacggcaaaagttctcctga

DBGET integrated database retrieval system