KEGG   Acyrthosiphon pisum (pea aphid): 100168519Help
Entry
100168519         CDS       T01076                                 

Definition
ubiquitin carboxyl-terminal hydrolase 30-like
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.1.2.15]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100168519
Peptidases [BR:api01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100168519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 445 aa AA seqDB search
MFKINGNHLAFIGVTGAGLALVAYVLFGPSNKPKSTKKSGFCGLQNLGTTCYLNTLLQSL
ASCPMFVEWLDQQSKSSTVSYTLNKTLKFLTGARYNDDGILSPIELVTVLTKVGFHFKPN
LQADVHELFIHLFSVIEDEAYKTSCSLADCLETNGNLIEKGNIQNSMKIVNNIGINVYNP
SKAEGDLLENAAVISNNILNISGNIVLQGDRKSLDKNQNVKPSPFLGYLSNNIECSLCHH
KLSLNYEKFYVISLSLPEYPQLKIELTDILDQYIKQEKLENLPCTNCDKNNTKTDGKSYI
KSVKFGKLPSCLCLHLVRTQYSKDRPLKRKDFVGFPEYLYMDKYTSVYDQLSKLRQSREK
SSSEPLERLRGNKYTYRLKAVIVHVGEHNTGHFSTYRRGTTTDHSRHRCSETRWYFTSDA
HIEEVTLQQVLQSVFYMLFYEKCDT
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagataaatggaaaccatttagcttttattggtgtaactggagctggattagca
ttagtagcctatgtattatttggtccatcaaataaaccaaaatcgacaaaaaaaagtggt
ttttgtggattacaaaatttaggaactacttgctatttaaatactttattacaatcgctt
gcctcttgtcctatgtttgtcgagtggcttgatcaacaatctaagtcttcaacagtgtct
tacacattaaataaaacacttaaattcttaacaggggctaggtacaatgatgatggtata
ctttctccaatagaattagtaactgtattgacaaaagttggatttcatttcaaaccaaac
cttcaagctgatgttcatgaattgttcattcatttattttctgtgattgaagatgaagca
tacaaaacaagttgtagtttggctgattgtttagaaactaatgggaatttaatagaaaaa
ggaaatatacagaattcaatgaagattgtaaataatatcggcattaatgtatataatcca
tccaaagctgaaggagatttattagaaaatgcagctgtaatatctaataatattcttaat
atttctggaaacatagtcttacaaggtgataggaagtcgttggataaaaatcaaaatgta
aaaccatcaccttttttgggttatttgtcaaataatatagaatgttctttatgtcatcac
aaattatccttaaattatgaaaaattttatgttatatcattgagtttacctgaatatcct
caactgaaaattgaattaacagatattttagaccagtatataaagcaagagaaactagaa
aatctgccatgtacaaactgtgataaaaataataccaaaactgatggaaaatcatatata
aagagtgtcaaatttggaaaattaccttcatgtttatgtctacacttagtaagaactcaa
tattctaaagatagaccattaaaaagaaaagattttgtgggatttccagaatatttatac
atggataaatataccagtgtttatgaccaattaagcaagcttaggcaatctagagaaaag
agttcttctgaaccattagaaaggttaagaggaaataagtatacatataggttaaaagct
gtcattgtccatgttggtgagcataatactggtcatttcagtacttacaggagaggaacc
acaacagatcattctagacacaggtgcagtgaaacaaggtggtatttcacttctgatgca
cacattgaagaagttacattacaacaagttctacaatcagttttttatatgttgttttat
gaaaaatgtgacacatag

DBGET integrated database retrieval system