KEGG   Acyrthosiphon pisum (pea aphid): 100168660Help
Entry
100168660         CDS       T01076                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:api00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 382 aa AA seqDB search
MKSDILYFSRPGIKKNAILTFCIGVIFGIFFAYTTVTITECHFKNIKIFPSKFSYDSVRY
SDRHSHGHDNEGSFNDSLIMKDHGENETLHFHEDLVAQELKKRIRVLCWIMTSPSNHIKK
ARHVKATWGKRCNTLLFMSTVKDKSLPSIALPVKEGRDSLWGKTKEAFKYIHKHYNDYDY
VLKADDDTYVVVENLRYMLTSFNPKDPIFLGCRFKPYVKQGYMSGGAGYLLSKESVKRFV
EKAIPHKQCRQDNGGAEDVEIGICLQLVGVRAEDSRDSLGRGRFFPFIPEHHLIPGHTDP
SFWYWKYIYYPIVEGMDCCSDTAISFHYVNPNNMYVLEYLIYHLRPFGVTQNIDKATVNK
IYPNKESNATKTDQPINKTQHV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtgacattttatattttagccgacctggcattaaaaaaaatgccattctaacc
ttttgtatcggtgtaatatttggaatattttttgcttatactacagtaaccattactgaa
tgccattttaaaaatatcaaaatatttccatcaaagttttcatatgattcggttagatac
agtgaccgtcattcacatggacatgataatgaaggttcattcaatgattcacttattatg
aaagaccatggggaaaatgagacattacactttcatgaagatctcgtagctcaagaactt
aaaaaacgaattagagttctttgttggatcatgactagtcctagtaatcacattaaaaaa
gcaagacatgtaaaagctacatggggtaaacgttgcaatacattactttttatgagtact
gttaaagataaaagtttaccttcaattgcattaccagttaaagagggtagagattccctt
tggggtaaaactaaagaagcatttaagtacatacataaacattataatgattatgattat
gtattgaaagctgatgatgacacgtatgttgtagtagaaaacttgaggtatatgttaact
tcatttaacccaaaagatccaatcttcttaggttgtaggtttaaaccctatgttaaacag
ggatacatgagtggcggtgcaggttatttgctaagcaaagaatcggttaagaggtttgtt
gaaaaagctatacctcataaacaatgtcggcaagataatggtggagccgaagatgtagaa
attggtatttgtcttcaattagttggagtaagagctgaagattctcgagatagtttaggt
cgtggacgtttttttccatttattccagaacaccatcttatacctgggcatacagatcca
agtttttggtactggaaatatatttactatccaatagtagagggcatggattgttgttca
gataccgcaatttcattccattatgtgaatcctaataatatgtatgttctcgaatatcta
atttatcatttacgaccatttggagtgactcagaatattgataaagctaccgtaaacaaa
atttaccctaacaaagagagcaatgctacaaagactgatcagccaataaacaaaacacaa
catgtataa

DBGET integrated database retrieval system