KEGG   Acyrthosiphon pisum (pea aphid): 100168664Help
Entry
100168664         CDS       T01076                                 

Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00860  Porphyrin and chlorophyll metabolism
api01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100168664
Enzymes [BR:api01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     100168664
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     100168664
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 MCRA DAO Pyr_redox_2 FAD_binding_3 FAD_binding_2 Thi4 Pyr_redox XFP_N Fim-adh_lectin Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 100168664
NCBI-ProteinID: XP_001952405
APHIDBASE: ACYPI009344
UniProt: J9K8U2
Position
Un
AA seq 487 aa AA seqDB search
MTIAILGGGLAGLSAAYYLKREGGIEKNQSIQIIEASDHTGGWIQSWKDENTNVISELGP
RTIRGRGKSANNTFSLIKDLGIEDLVRNVGIDASARYIFANGNIHQLPMSVWKALFTVNQ
PFTKPWIYYVLRECFSSNNSKDKLSDVQNNDESAYDFFCRTFGQEFADYLISPLLCGVCG
GNAKQMSVKFMFGALYEAERKHGTVGLGLLKEQLSSIWNREKVKDTKGTNTVKPPPSVYY
LDGGLQRLIHALDIENESQGIHTNLNTQCTELHFYENGNGARIGFSNGKQLECAHVISAL
PAHKLASLFHVKSQHSTLTQLLTSIPMVSIATVNLTYDDPKVMGPYKGFGVLSSPLEKLS
LLGIIFNNYIYGHSDRVDLTVMMGGYGFKEHFVKNSKCLSEEKLADTAVGHVKRVLDIQS
KPNTYSTQILNDCIPQYTVGHYERVTKIQEYINVRRLPLTLVGSSYAGISVNDVIYASMT
AMRKLCR
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaccatagccattttaggcggtggactcgctggtctaagtgctgcatattacctgaaa
cgagaaggaggaattgaaaaaaaccaatcaatacaaattattgaagccagcgatcataca
ggtggctggatccagtcgtggaaggacgaaaacactaatgttattagtgagcttggtccg
agaacgattagaggtcgcggaaaatcggcaaacaatacgttcagtttaataaaagattta
ggtattgaagatctagtgcgcaacgtaggtattgatgcttctgctaggtacatatttgca
aatggaaatatacatcaattacctatgagtgtttggaaagctctgtttacagtaaatcaa
ccattcactaaaccatggatttattatgtcttacgtgagtgtttttcatcaaataatagc
aaagataagttatctgatgttcaaaataatgatgaaagtgcttatgactttttttgtcgc
acgttcggacaagaatttgctgactacttgatttcaccgttattgtgtggagtatgcggt
ggaaatgctaagcaaatgagtgttaagtttatgtttggtgctttatatgaagcagaacgt
aaacatggaacagttggattagggttattaaaagaacagttaagttccatttggaatcgt
gaaaaagtaaaagatacaaaaggaacaaatactgttaaacctcccccatcagtttattat
ttagatggaggcctacaacgtttaatccatgctttagatattgaaaacgagtctcaagga
attcatacaaatctaaatactcagtgtacagagttgcatttttacgaaaacggaaatggt
gccagaattgggttttctaatggtaaacagttggaatgtgcacatgttattagtgcatta
cctgcacataaattagcttcactctttcatgttaagtctcaacattcaacattgacacag
ctattaacatctatacccatggtatctatagcaacagttaatttaacatacgatgatcct
aaagtgatgggtccttacaaaggttttggagttctttcttcgccacttgaaaaattgtct
ctgttgggtataatatttaataattatatttatggacacagtgatcgtgttgatcttaca
gtcatgatgggtggatatggatttaaagaacattttgtcaaaaactctaaatgtttgtct
gaagaaaaacttgctgatacagctgtaggtcatgtcaaacgtgtgcttgatattcaatca
aaacctaatacatacagtacacaaatattaaatgattgcattccacaatatacagttgga
cattatgaacgtgtaacaaaaattcaagaatatattaatgttaggcgtttgccgctgaca
ttggttggttcatcgtatgctggaattagtgttaatgatgtcatatatgcatcaatgact
gcaatgcgaaaattatgtagataa

DBGET integrated database retrieval system