KEGG   Acyrthosiphon pisum (pea aphid): 100168664Help
Entry
100168664         CDS       T01076                                 

Definition
protoporphyrinogen oxidase-like
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100168664
Enzymes [BR:api01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     100168664
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 487 aa AA seqDB search
MTIAILGGGLAGLSAAYYLKREGGIEKNQSIQIIEASDHTGGWIQSWKDENTNVISELGP
RTIRGRGKSANNTFSLIKDLGIEDLVRNVGIDASARYIFANGNIHQLPMSVWKALFTVNQ
PFTKPWIYYVLRECFSSNNSKDKLSDVQNNDESAYDFFCRTFGQEFADYLISPLLCGVCG
GNAKQMSVKFMFGALYEAERKHGTVGLGLLKEQLSSIWNREKVKDTKGTNTVKPPPSVYY
LDGGLQRLIHALDIENESQGIHTNLNTQCTELHFYENGNGARIGFSNGKQLECAHVISAL
PAHKLASLFHVKSQHSTLTQLLTSIPMVSIATVNLTYDDPKVMGPYKGFGVLSSPLEKLS
LLGIIFNNYIYGHSDRVDLTVMMGGYGFKEHFVKNSKCLSEEKLADTAVGHVKRVLDIQS
KPNTYSTQILNDCIPQYTVGHYERVTKIQEYINVRRLPLTLVGSSYAGISVNDVIYASMT
AMRKLCR
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaccatagccattttaggcggtggactcgctggtctaagtgctgcatattacctgaaa
cgagaaggaggaattgaaaaaaaccaatcaatacaaattattgaagccagcgatcataca
ggtggctggatccagtcgtggaaggacgaaaacactaatgttattagtgagcttggtccg
agaacgattagaggtcgcggaaaatcggcaaacaatacgttcagtttaataaaagattta
ggtattgaagatctagtgcgcaacgtaggtattgatgcttctgctaggtacatatttgca
aatggaaatatacatcaattacctatgagtgtttggaaagctctgtttacagtaaatcaa
ccattcactaaaccatggatttattatgtcttacgtgagtgtttttcatcaaataatagc
aaagataagttatctgatgttcaaaataatgatgaaagtgcttatgactttttttgtcgc
acgttcggacaagaatttgctgactacttgatttcaccgttattgtgtggagtatgcggt
ggaaatgctaagcaaatgagtgttaagtttatgtttggtgctttatatgaagcagaacgt
aaacatggaacagttggattagggttattaaaagaacagttaagttccatttggaatcgt
gaaaaagtaaaagatacaaaaggaacaaatactgttaaacctcccccatcagtttattat
ttagatggaggcctacaacgtttaatccatgctttagatattgaaaacgagtctcaagga
attcatacaaatctaaatactcagtgtacagagttgcatttttacgaaaacggaaatggt
gccagaattgggttttctaatggtaaacagttggaatgtgcacatgttattagtgcatta
cctgcacataaattagcttcactctttcatgttaagtctcaacattcaacattgacacag
ctattaacatctatacccatggtatctatagcaacagttaatttaacatacgatgatcct
aaagtgatgggtccttacaaaggttttggagttctttcttcgccacttgaaaaattgtct
ctgttgggtataatatttaataattatatttatggacacagtgatcgtgttgatcttaca
gtcatgatgggtggatatggatttaaagaacattttgtcaaaaactctaaatgtttgtct
gaagaaaaacttgctgatacagctgtaggtcatgtcaaacgtgtgcttgatattcaatca
aaacctaatacatacagtacacaaatattaaatgattgcattccacaatatacagttgga
cattatgaacgtgtaacaaaaattcaagaatatattaatgttaggcgtttgccgctgaca
ttggttggttcatcgtatgctggaattagtgttaatgatgtcatatatgcatcaatgact
gcaatgcgaaaattatgtagataa

DBGET integrated database retrieval system