KEGG   Acyrthosiphon pisum (pea aphid): 100168771Help
Entry
100168771         CDS       T01076                                 

Definition
ubiquitin carboxyl-terminal hydrolase 36-like
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
api  Acyrthosiphon pisum (pea aphid)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 920 aa AA seqDB search
MPAASNQIGSALFQSLSKKVTDRRTHHSSVADDRSCYLYIASSRILDKSIEFEMLDHKPS
MLSQMKNNCIMLLQNGCSKKDIIKKNERLNGDTNKISHLPKPKVVLYPPERVQLGWQDKK
MSVGSGLDNPGVICYINSTLQALFHIPAFTNWLMSDEQHQKTCQQKTGFQKDCIVCMVCN
TFTLSQKHTGSSFKASIITNRLSLICKHLSTYRQEDAHEFLRYLIESMERCYLSVLGHAA
KSLDNYSKETTPINQIFGGYIRTEVTCGKCGHISTTFQHFQDLILDIRHSDNVNDALDNY
FEKEPLDESYVCERCRRQVAADKKFSIERAPNVLCIQLKRYSVGMGGFSGNKNSKAIQIN
ERLDLSSYQFDHHKFKIDARPLRYHLVSMVIHYGSSLHSGHYTTLGLTPSGSYYYFNDSN
VYQTNFKNYSTSNDSYIIFYELEPSENMNNTNLESKTSTVTSTSTCKPSVNGFFSNKSNG
VTKPLNGVTKPLNGLNNIKKNIIKDKKSQIYDKWDSNIKMLKQGQQKDKSLIENTWNSNS
KTIEPTTNGIKPSLIYNSLVPYIDSDKEGSDDENSSLSGEDNASSPVILGKVKHSLDQRV
PDKKPLVMRPKENPSEVASETPPKKCLVLKPPNDDSPINERDKEILPAKKCLVLKPKDEE
PLEVKPESEPVKKCLVRIPKDDNESSNTTKASHSTEGKDSEKKNRRRENGILEFDVNKPK
ARLDHNYNGTKSPSDNKTNGKCLNGNDSLDDKPWSKLSNGNNHKHSNGTKNWPKFTNDFQ
TNGNIKSNGNNFKDSMKSRTHLGFGGDVKTWNGEKSFVDREAEQDKSNGVKRSFDDEYNE
DFDRGVVKKKKFDSKNHHSKENGSNALQMLHNQLNQFNGKMGRSKITWMNRTKNYRQYNN
GYRHNGSSGNNGGGYKKPSL
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgccagccgcaagcaatcaaataggttctgctttgtttcagtctctttctaagaaagtt
actgatcgccgaactcatcattcatctgtggcagacgaccgttcttgttacttatacata
gcatcaagcagaattttagataaaagtatagaatttgaaatgttagaccataaaccatca
atgctatctcagatgaaaaacaattgtatcatgttactacaaaatggctgtagtaaaaaa
gatattattaaaaaaaatgaaaggcttaatggtgatactaacaaaatatcccacttacct
aaacctaaagtagtattatatcctcctgaacgtgtacaactaggctggcaggataaaaaa
atgtcagttggttccggattagataatcctggtgtaatatgttacatcaattctacatta
caagcactatttcatatccctgcatttacaaattggctaatgagtgatgaacaacatcaa
aaaacatgtcaacaaaaaactggatttcaaaaagattgtattgtatgtatggtctgtaat
acattcacactatctcaaaaacacactggttctagcttcaaagcatcaatcataactaat
cgcctttcattaatatgtaaacatttgtcaacatatcgtcaagaagatgcccatgagttc
cttcgttaccttatcgaaagtatggaacggtgctatttgtccgttttaggacatgctgct
aaatccctagacaattattctaaagaaaccacacctattaaccaaatatttggtggttat
atccgcactgaagtaacgtgtggtaaatgtggacacatatcaactacatttcaacatttc
caagatctcatacttgatatcaggcactctgataatgttaacgacgctttagataactat
tttgaaaaagaaccattagatgaatcatatgtatgtgaaagatgtcgacgacaagttgct
gctgataaaaagttctccattgaaagagcaccaaacgttttatgcattcagctgaaaagg
tacagtgttggtatgggtggatttagtggaaataaaaacagtaaagctattcaaataaat
gaacgattagatttatccagttatcaatttgatcaccataagtttaaaattgatgctcga
ccattaagataccatctggtatccatggtaattcattatggttcaagtttacatagtgga
cattacacaactcttggtttaacaccctctggatcttattactatttcaatgattcaaat
gtttatcaaacaaatttcaaaaattattcgacaagtaatgattcctatataatattttat
gaattggaaccatcagaaaacatgaataacacaaatttagaaagtaagacatcgactgta
acgtctacttcaacttgtaaaccgtctgtaaatggctttttttcaaacaagagcaatgga
gttacaaagcctttaaatggtgttacaaaaccattgaacggtttaaacaatattaaaaaa
aatattatcaaagacaaaaaaagtcaaatatatgataaatgggattcaaatattaaaatg
ttaaaacaaggacaacaaaaagataaatcactaattgagaacacttggaattcaaatagt
aaaacaatagaacctacaactaatggaatcaaaccatctttaatttataatagcttagta
ccttatatcgattctgataaagaaggtagtgatgatgagaatagttcactatctggtgaa
gataatgcttcttcgcctgtgatattaggaaaagtcaaacactcattagaccaaagagtt
cctgataaaaagcctttagttatgagaccaaaggaaaatcctagtgaagttgcttcagaa
acacctcctaaaaaatgtctagtattgaaaccaccaaatgatgattctcctattaatgaa
cgagacaaagaaattcttccagcaaaaaaatgtttagttttgaaacctaaagatgaagaa
ccattagaagtgaaacctgaatctgaacctgtcaaaaaatgtttggttagaattccaaaa
gatgataatgaatcttctaatactactaaggcatctcattccactgaaggaaaagattca
gaaaaaaaaaaccgccggcgtgaaaatggaattttggaatttgatgttaataagcccaaa
gcccgacttgatcataattataatggaactaagtcaccatccgataacaaaacaaatgga
aaatgtttaaatggaaatgattctcttgatgataaaccttggagtaagttatcaaatggg
aataaccataaacattcaaatgggacaaagaactggcccaagtttaccaatgactttcaa
actaatggtaatattaaatctaatggcaacaattttaaagatagtatgaagtcacgaacg
catttgggttttggtggagatgttaaaacctggaatggtgaaaaaagctttgtagaccga
gaggctgaacaggataaaagtaatggagttaaacgttcatttgatgatgaatacaatgaa
gattttgatagaggggttgtaaaaaagaagaaatttgatagtaagaatcaccactcaaaa
gaaaatggttccaatgccttgcaaatgttacataatcaattaaatcaatttaatggtaaa
atgggacgaagtaaaatcacttggatgaatcgaaccaaaaattacagacaatataacaat
ggatatcgtcacaatggcagtagtggaaataatggcggaggatataagaaacccagttta
tag

DBGET integrated database retrieval system