KEGG   Acyrthosiphon pisum (pea aphid): 100168783Help
Entry
100168783         CDS       T01076                                 

Definition
neutral alpha-glucosidase AB-like
Orthology
K05546  
alpha 1,3-glucosidase [EC:3.2.1.84]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Module
N-glycan precursor trimming
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:api00510]
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:api04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 907 aa AA seqDB search
MSSFLHVILFLVCIIGSTVYSVDRGNFKTCEQSNFCKRCRSMNKNQKTAFELVPDSVILT
DKYFEALISNTNYDDVSLRMRLDGLKDSTLRLRINKDGNQMYNRFQPVHALVSEPITESM
IMARNASTVELELSKIIKVYITIAPFKLDVYVNEELTIGVNHDNLMQFEHYRPKPESIAD
NEIGSWEEYFKEHQDSKPRGPSAVSMDFKLYSSTSLYGLPEHADSLALKGTTGNDPYRFY
NLDVFEYELYNGMGLYGAVPFLIGHGKKNSVGVFWLNAAETWVDIAGVKGNTEHTSVVES
LVNLVSGSSTEKDIPRAHFISECGIIDFFIMLGPKPLDVTRQYSSLTGTTPLPPLFSLAY
HQCRWNYNDQKDVHDVETNFDVNDIPMDVMWLDIEYTDSKKYFTWDPVKFSEPLEMVNNL
TSRGRKLVTIIDPHIKRDSNYFLHNDAINNDLYVKNKDGDVYEGWCWPGSSSYLDFMNPK
VQDYYASRYSIDNFVGPTEDIFIWNDMNEPSVFNGPEVTMPKDCIHHGGYEHRDIHNIYG
LLQVMSTYDGLLKRSNGKKRPFILTRSHFAGTQRFAAVWTGDNMADWSHLKISLPMCLSL
AISGISFCGADVGGFFNNPDKELLIRWYQTGAFLPFFRSHAHIDTKRREPWLFDEQTTFL
IRDAIRTRYTLLPLWYSLFKNHELTGAPVIRPLFFEFPHEEQLNNIDNEFMVGDILLVCP
VLDQNVQELTCYFPGHEEIWYDRDTYQPIKTNGLMKIQAPINKVPVYQRGGTIVPTKQRV
RRSSVLMKDDPYTLIVAIDLKAIAKGSLYIDDEESFEYRDGHFIYVEYEYINNQLISKCL
HCKDFSTKSWVEKVMIVGIPNVFTKASIQVNGGSLSELSVLYNTHNQVLTVRKPAVGIAQ
NWTITLL
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtttcctacacgtaatactttttttggtatgtattattggttcaaccgtatat
tcggttgaccgtggtaattttaagacatgcgaacaaagtaacttttgtaagcgttgtcgc
tccatgaacaaaaaccaaaaaaccgcgtttgaactagtaccagacagtgttatattgacg
gataaatacttcgaagcattgatatcaaatacaaactatgatgatgtttcattacgaatg
cggctggatggtctcaaggatagtacacttcgtcttcgtatcaacaaagatggaaatcaa
atgtataacaggtttcaaccagtgcatgctctcgtatctgaaccaattacagagtcaatg
attatggctcgaaatgcatcaacagttgaattagaattgagtaaaattattaaggtgtat
atcacaatagccccatttaaattggatgtttatgttaacgaagagttgaccataggggtg
aaccatgataatctaatgcaatttgaacactataggcctaaaccagaatctattgcagac
aatgaaatagggtcttgggaagaatattttaaggaacatcaggattctaaaccacgtgga
ccttctgcagtttcaatggacttcaaattatattcgtctacttctctatacggactgcca
gaacatgcggacagtttagctctcaaaggtaccactgggaatgatccgtatcgattttat
aatttggatgtttttgaatatgaattgtacaacggaatgggattatacggagccgttcca
tttttaataggacatggaaaaaaaaacagtgttggggtgttttggttgaatgctgctgaa
acatgggtagatattgcaggtgtaaaaggaaacacagagcacacatcagttgtggagtca
ttagttaatttagtttcaggatcgtctactgaaaaagacattcccagagctcattttatt
tctgaatgtggtatcattgattttttcattatgttgggtcctaaacctctagatgtaacc
agacaatattcttcactaacaggaactactccattacctccactattttctttggcttac
catcagtgtcgatggaattacaatgaccaaaaagatgtccacgatgtagaaacaaatttt
gatgtcaacgacatacctatggatgtcatgtggttagatattgagtatacggatagtaaa
aaatattttacctgggatccagttaaattctctgaacctttagaaatggttaataattta
actagcagaggaagaaagttggtgactattattgatccacacatcaaacgcgattccaac
tactttcttcacaacgatgcaatcaataatgatttatatgtgaagaataaagatggtgac
gtgtacgaaggttggtgttggccaggatcttctagttatttggatttcatgaaccctaaa
gtacaagattattatgcttctcgttattctattgataattttgtcggtcctacagaggac
atttttatatggaatgatatgaatgaaccttctgttttcaatggaccagaagtaacaatg
ccaaaggattgtattcatcatggtggttatgaacacagagatatacataacatttatgga
ctgttgcaagtcatgagcacatatgatggtctactgaaacgatcaaatggcaaaaaacgg
ccatttattttgacccgatctcattttgctggtacacaacgttttgctgctgtgtggact
ggtgataatatggctgactggagtcatttaaaaatatctttaccaatgtgtctctcattg
gcgatttcgggtatatcattttgtggtgcagatgtgggcggattcttcaataaccctgat
aaagaattacttatccgatggtaccaaactggtgcctttttgccttttttcagaagtcat
gctcacatagatacaaaacgtcgagaaccgtggttatttgatgaacaaactacatttttg
atccgtgatgccatcagaacaagatatacattgttaccgctgtggtactcattgtttaaa
aaccatgaattaaccggagcacctgttatacgtccattattttttgagtttcctcatgaa
gaacaactgaacaacatcgacaatgaatttatggttggtgatatcttgttagtgtgtcct
gtattagatcaaaatgtacaagagttgacttgttatttccctggtcacgaggaaatttgg
tatgatcgagatacttaccaaccaatcaaaactaacgggctgatgaaaatacaagcgcca
atcaacaaggtgcctgtatatcaacgcggtggtacaatagttcctactaagcaacgtgtt
cgccgatcatctgtcttaatgaaggacgacccgtacactttaattgtagcaattgacctg
aaagctatagctaagggatcattgtatattgatgatgaggaaagttttgaataccgggat
gggcactttatctacgttgaatatgaatacatcaacaaccaattgatctcaaaatgttta
cactgtaaagatttcagtactaaatcatgggtggaaaaagtcatgattgttggtattccc
aatgtatttaccaaagccagtatacaggtcaatggtggtagtttgtctgaattatccgtt
ttatacaatactcataatcaagtattaacagtgcggaaacctgctgtcggaatagctcaa
aattggacgattactctactttaa

DBGET integrated database retrieval system