KEGG   Acyrthosiphon pisum (pea aphid): 100168802Help
Entry
100168802         CDS       T01076                                 

Definition
(RefSeq) cartilage oligomeric matrix protein
  KO
K04659  
thrombospondin 2/3/4/5
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Phagosome
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:api00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100168802
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100168802
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100168802
  Exosomal proteins of colorectal cancer cells
   100168802
  Exosomal proteins of bladder cancer cells
   100168802
Cell adhesion molecules and their ligands [BR:api04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     100168802
  Beta3 integrins
   alpha IIb  beta 3
    ITGB3; integrin beta 3 [KO:K06493]
     100168802
   VNR
     100168802
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   100168802
Glycosaminoglycan binding proteins [BR:api00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   100168802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
APHIDBASE: 
UniProt: 
Position
Un
AA seq 1061 aa AA seqDB search
MRATAIFVALAGALLVLSADAASVDNEVTKAVEDAVSSDRFTIVIKDDGPPNGRKHRKPE
TVATIEFPGYYQFTLKIDRTEGQVIVSTKSNGNTVTENYNVKSLINNTSSSKTLVLAVDQ
RKPGATMTLYVNCEHFGTLRTIKTLREVYFDMRDPHLQMTHERRFQIKVFPDTDWKTTLT
AQKCPTIDDGSDDVELMPAMQPLPVTEIGIRMPSIGRGDIPINHDCDDLFFVKTIQELMQ
MVKKLREDVEAQRLEIYRLRQLLEQCDDFCRPGGGNIPTLPPPKPSCNSSPPVCYPGAEC
RDTPDGPRCGRCPQGMVGDGKMCKPGRTCAVKPCAPGVRCQDTVEGFRCGPCPEGFIGDG
QRCRPRGCDLAPCSPGVQCLPCEEPPFFKCGSCPTGFTGNGTNCVDLDECDLDEPCDPRV
QCTNLRPGYKCGQCPPGYTTVGPSQGIGAEGTRRTDEGRHRCVDIDECSDGRNGGCAPNS
QCINTEGSYRCGGCRSGYIGNQSLGCLSVENLKKTPWMCPDGTMCHQNGECVRSTTGKFS
CECVVGWAGNGKICGPDLDLDRWPDIDLACNDTRCKKDNCVRVPNSGQEDADHDGIGDVC
DDDADNDGVPNTPDNCPLVSNPDQMDSDQDGADKKGDACDNCPTIPNLDQHDTDNDGIGD
ACDADIDNDGVLNHEDNCPKKANPDQRDTDGDGLGDVCDNCPSMHNPTQTDSDKDLIGDA
CDSDIDRDRDGIQDSVDNCPKVANSNQLDTDGDGKGDECDPDIDGDGIGNTQDNCMLVYN
PDQADFDGNGIGDICQDDNDYDKVPNHLDNCPNNSKIFTTDFRTYQTVVLDPEGDSQIDP
NWVVYNKGAEFVQTMNSDPGLAVGYDSFGGVDFEGTFFVDTDIDDDYVGFVFSYQDNHKF
YTVMWKKGTQTYWQATPFRAVAEPGIQIKAVHSETGPGQMLRNALWNTESTDKQVKLLWK
DPRNIGWKGKTAYRWILLHRPKIGLIRLRIFEGQNMVTDSGNVFDYTFKGGRLGVFCFSQ
EMIIWSDLVYRCNDNIPEAIYRELPPKLQQEVQLDTRRVSN
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgagagcaacggcgattttcgtcgctcttgccggcgcgttactggtgttaagcgccgac
gcggcctccgttgacaacgaagtcacgaaagccgtcgaagacgcggtgtccagcgataga
tttacaatagtgatcaaagacgatggaccgccgaacggacggaagcaccgcaaacccgaa
actgtggccaccattgaatttcccggttactatcaattcacgttaaagatcgataggact
gaaggacaagtaatcgtatcaaccaagagcaatggcaatacagtaactgagaactataat
gtaaaatctttgattaataatacatcatcttcaaagacacttgtgttggccgtggatcag
aggaaaccaggggctaccatgacattatatgtcaactgcgagcacttcggtacactgcgg
acgattaaaactcttcgagaagtgtattttgacatgagggatcctcatttacagatgacg
cacgaaagaagattccaaataaaagtattcccagatacagattggaaaactactttgacg
gcacaaaaatgtccaactattgacgatggttcagacgacgtagaactaatgcctgcgatg
caaccacttccagttaccgaaattggaattcgaatgccaagtattggaagaggtgatatt
ccaatcaatcacgactgtgatgatctgtttttcgtaaaaactattcaagagttgatgcag
atggttaaaaaacttagagaagacgttgaagctcaacgactcgagatttatagactacgc
caattgcttgagcagtgcgacgacttctgcaggccaggtggtggtaacataccgaccctg
ccgccgccgaaacctagttgcaacagcagtcccccggtgtgttatcccggagcggagtgc
cgtgacacgcccgacggaccgcggtgtggccggtgtccacaaggaatggtgggcgacggc
aagatgtgcaaaccaggccggacatgcgcggtgaagccatgtgctccaggcgtcagatgt
caagacaccgtagaaggtttccgatgcggtccctgtccggaagggttcatcggcgacggt
cagaggtgccgtccacgtggatgtgacttagccccttgttctccaggtgtgcaatgcctg
ccgtgtgaagaaccacctttcttcaagtgcggcagttgtccaacggggtttactggcaat
ggaacgaactgcgttgatctagatgagtgtgatctggatgaaccttgtgatccccgagtg
cagtgcacaaaccttcgacctggttacaaatgcggtcaatgtccaccgggttacacgacc
gtgggcccatcacagggtattggtgccgaaggcacaaggaggacggacgagggtcgtcac
cggtgcgtggatattgacgaatgctccgacggccgaaacggtggctgtgcacccaactcg
cagtgcataaacaccgaaggttcttatcgttgcggtggctgtcggtcaggctacatcgga
aaccagtcgttgggctgtttatcggtcgaaaatctaaagaaaaccccgtggatgtgtccg
gatggtacgatgtgtcatcaaaacggagagtgtgttagatcaactactggtaaattttct
tgcgaatgtgtcgtaggctgggctggaaacggcaaaatatgcggaccagacttggatttg
gatagatggccggacatcgatttggcatgcaatgacacgcggtgtaaaaaggacaattgc
gtcagggtacccaattcgggacaagaagacgcggaccacgacggcattggcgacgtgtgc
gatgacgacgccgacaacgatggcgtgccaaacacaccggacaactgtccgttggtgtcc
aacccggaccaaatggattccgatcaagatggtgcggacaaaaaaggcgatgcttgcgac
aactgcccgaccataccgaatctagatcagcacgacacggacaacgatggaataggagac
gcttgcgatgcggatattgacaacgacggggtactgaaccacgaagacaactgtccgaaa
aaggcaaatcccgatcagagggacacggacggcgatggtcttggtgacgtttgtgacaac
tgtccgagtatgcacaacccaacacaaacagattccgataaagacctgataggtgatgct
tgcgacagcgacatcgacagggacagggacggcattcaggatagcgtagacaattgtccc
aaagtagcaaattccaatcagctggatacagatggtgacggcaagggagacgaatgtgat
ccggacattgacggcgatggcattggcaacacgcaggataattgcatgcttgtgtacaat
ccagaccaggccgacttcgacggcaacggcatcggggatatatgtcaagatgacaacgac
tacgataaggtgccaaaccatttggacaactgccccaataactccaagatattcaccacg
gactttaggacataccagacagtggtgctagacccggaaggcgattcgcagatcgatcca
aactgggtggtgtacaacaagggggcggaatttgtacagactatgaacagcgatcctggt
ttggcagtaggttacgattcgtttggtggcgttgactttgaaggtacattcttcgtggac
accgacatcgatgacgactacgtaggttttgtgttcagttaccaggacaatcacaagttt
tatacagtgatgtggaaaaaaggcacgcaaacatactggcaagcgacaccgtttagagct
gtagcggaaccaggaatacagatcaaagcagtacattcggaaactggaccaggacaaatg
ttgagaaacgccctgtggaatacagagagcacagacaaacaggtgaaactattgtggaaa
gatccacgcaacattggttggaaaggaaaaactgcctatagatggatactattgcatcgt
ccaaagattggtcttattagattgagaatatttgagggccaaaatatggtaacagattcc
ggaaacgtgtttgattacacatttaaaggtggtaggttaggagtgttttgcttctctcaa
gaaatgatcatatggtcagatttggtttatcgctgtaatgataatataccagaggctatt
tatcgtgaattaccacctaagttacaacaagaagtacaattggacacaagacgggtttcc
aactaa

DBGET integrated database retrieval system