KEGG   Acyrthosiphon pisum (pea aphid): 100168802Help
Entry
100168802         CDS       T01076                                 

Definition
thrombospondin-3-like
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Phagosome
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:api00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100168802
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100168802
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100168802
  Exosomal proteins of colorectal cancer cells
   100168802
  Exosomal proteins of bladder cancer cells
   100168802
Heparan sulfate/heparin binding proteins [BR:api00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100168802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1061 aa AA seqDB search
MRATAIFVALAGALLVLSADAASVDNEVTKAVEDAVSSDRFTIVIKDDGPPNGRKHRKPE
TVATIEFPGYYQFTLKIDRTEGQVIVSTKSNGNTVTENYNVKSLINNTSSSKTLVLAVDQ
RKPGATMTLYVNCEHFGTLRTIKTLREVYFDMRDPHLQMTHERRFQIKVFPDTDWKTTLT
AQKCPTIDDGSDDVELMPAMQPLPVTEIGIRMPSIGRGDIPINHDCDDLFFVKTIQELMQ
MVKKLREDVEAQRLEIYRLRQLLEQCDDFCRPGGGNIPTLPPPKPSCNSSPPVCYPGAEC
RDTPDGPRCGRCPQGMVGDGKMCKPGRTCAVKPCAPGVRCQDTVEGFRCGPCPEGFIGDG
QRCRPRGCDLAPCSPGVQCLPCEEPPFFKCGSCPTGFTGNGTNCVDLDECDLDEPCDPRV
QCTNLRPGYKCGQCPPGYTTVGPSQGIGAEGTRRTDEGRHRCVDIDECSDGRNGGCAPNS
QCINTEGSYRCGGCRSGYIGNQSLGCLSVENLKKTPWMCPDGTMCHQNGECVRSTTGKFS
CECVVGWAGNGKICGPDLDLDRWPDIDLACNDTRCKKDNCVRVPNSGQEDADHDGIGDVC
DDDADNDGVPNTPDNCPLVSNPDQMDSDQDGADKKGDACDNCPTIPNLDQHDTDNDGIGD
ACDADIDNDGVLNHEDNCPKKANPDQRDTDGDGLGDVCDNCPSMHNPTQTDSDKDLIGDA
CDSDIDRDRDGIQDSVDNCPKVANSNQLDTDGDGKGDECDPDIDGDGIGNTQDNCMLVYN
PDQADFDGNGIGDICQDDNDYDKVPNHLDNCPNNSKIFTTDFRTYQTVVLDPEGDSQIDP
NWVVYNKGAEFVQTMNSDPGLAVGYDSFGGVDFEGTFFVDTDIDDDYVGFVFSYQDNHKF
YTVMWKKGTQTYWQATPFRAVAEPGIQIKAVHSETGPGQMLRNALWNTESTDKQVKLLWK
DPRNIGWKGKTAYRWILLHRPKIGLIRLRIFEGQNMVTDSGNVFDYTFKGGRLGVFCFSQ
EMIIWSDLVYRCNDNIPEAIYRELPPKLQQEVQLDTRRVSN
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgagagcaacggcgattttcgtcgctcttgccggcgcgttactggtgttaagcgccgac
gcggcctccgttgacaacgaagtcacgaaagccgtcgaagacgcggtgtccagcgataga
tttacaatagtgatcaaagacgatggaccgccgaacggacggaagcaccgcaaacccgaa
actgtggccaccattgaatttcccggttactatcaattcacgttaaagatcgataggact
gaaggacaagtaatcgtatcaaccaagagcaatggcaatacagtaactgagaactataat
gtaaaatctttgattaataatacatcatcttcaaagacacttgtgttggccgtggatcag
aggaaaccaggggctaccatgacattatatgtcaactgcgagcacttcggtacactgcgg
acgattaaaactcttcgagaagtgtattttgacatgagggatcctcatttacagatgacg
cacgaaagaagattccaaataaaagtattcccagatacagattggaaaactactttgacg
gcacaaaaatgtccaactattgacgatggttcagacgacgtagaactaatgcctgcgatg
caaccacttccagttaccgaaattggaattcgaatgccaagtattggaagaggtgatatt
ccaatcaatcacgactgtgatgatctgtttttcgtaaaaactattcaagagttgatgcag
atggttaaaaaacttagagaagacgttgaagctcaacgactcgagatttatagactacgc
caattgcttgagcagtgcgacgacttctgcaggccaggtggtggtaacataccgaccctg
ccgccgccgaaacctagttgcaacagcagtcccccggtgtgttatcccggagcggagtgc
cgtgacacgcccgacggaccgcggtgtggccggtgtccacaaggaatggtgggcgacggc
aagatgtgcaaaccaggccggacatgcgcggtgaagccatgtgctccaggcgtcagatgt
caagacaccgtagaaggtttccgatgcggtccctgtccggaagggttcatcggcgacggt
cagaggtgccgtccacgtggatgtgacttagccccttgttctccaggtgtgcaatgcctg
ccgtgtgaagaaccacctttcttcaagtgcggcagttgtccaacggggtttactggcaat
ggaacgaactgcgttgatctagatgagtgtgatctggatgaaccttgtgatccccgagtg
cagtgcacaaaccttcgacctggttacaaatgcggtcaatgtccaccgggttacacgacc
gtgggcccatcacagggtattggtgccgaaggcacaaggaggacggacgagggtcgtcac
cggtgcgtggatattgacgaatgctccgacggccgaaacggtggctgtgcacccaactcg
cagtgcataaacaccgaaggttcttatcgttgcggtggctgtcggtcaggctacatcgga
aaccagtcgttgggctgtttatcggtcgaaaatctaaagaaaaccccgtggatgtgtccg
gatggtacgatgtgtcatcaaaacggagagtgtgttagatcaactactggtaaattttct
tgcgaatgtgtcgtaggctgggctggaaacggcaaaatatgcggaccagacttggatttg
gatagatggccggacatcgatttggcatgcaatgacacgcggtgtaaaaaggacaattgc
gtcagggtacccaattcgggacaagaagacgcggaccacgacggcattggcgacgtgtgc
gatgacgacgccgacaacgatggcgtgccaaacacaccggacaactgtccgttggtgtcc
aacccggaccaaatggattccgatcaagatggtgcggacaaaaaaggcgatgcttgcgac
aactgcccgaccataccgaatctagatcagcacgacacggacaacgatggaataggagac
gcttgcgatgcggatattgacaacgacggggtactgaaccacgaagacaactgtccgaaa
aaggcaaatcccgatcagagggacacggacggcgatggtcttggtgacgtttgtgacaac
tgtccgagtatgcacaacccaacacaaacagattccgataaagacctgataggtgatgct
tgcgacagcgacatcgacagggacagggacggcattcaggatagcgtagacaattgtccc
aaagtagcaaattccaatcagctggatacagatggtgacggcaagggagacgaatgtgat
ccggacattgacggcgatggcattggcaacacgcaggataattgcatgcttgtgtacaat
ccagaccaggccgacttcgacggcaacggcatcggggatatatgtcaagatgacaacgac
tacgataaggtgccaaaccatttggacaactgccccaataactccaagatattcaccacg
gactttaggacataccagacagtggtgctagacccggaaggcgattcgcagatcgatcca
aactgggtggtgtacaacaagggggcggaatttgtacagactatgaacagcgatcctggt
ttggcagtaggttacgattcgtttggtggcgttgactttgaaggtacattcttcgtggac
accgacatcgatgacgactacgtaggttttgtgttcagttaccaggacaatcacaagttt
tatacagtgatgtggaaaaaaggcacgcaaacatactggcaagcgacaccgtttagagct
gtagcggaaccaggaatacagatcaaagcagtacattcggaaactggaccaggacaaatg
ttgagaaacgccctgtggaatacagagagcacagacaaacaggtgaaactattgtggaaa
gatccacgcaacattggttggaaaggaaaaactgcctatagatggatactattgcatcgt
ccaaagattggtcttattagattgagaatatttgagggccaaaatatggtaacagattcc
ggaaacgtgtttgattacacatttaaaggtggtaggttaggagtgttttgcttctctcaa
gaaatgatcatatggtcagatttggtttatcgctgtaatgataatataccagaggctatt
tatcgtgaattaccacctaagttacaacaagaagtacaattggacacaagacgggtttcc
aactaa

DBGET integrated database retrieval system