KEGG   Acyrthosiphon pisum (pea aphid): 100168842Help
Entry
100168842         CDS       T01076                                 

Definition
neuropathy target esterase sws-like
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:api00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1131 aa AA seqDB search
MGLFDFTNSFRAIIYSPTFQQWITSTSSFMLLRENMLIIVVCILASMLLRFAFYKWKSKF
HVIRGSDICSVPKTRFRKRDRVLFYGRKMLRKVKSISGQVHGQGKKRKLVIKFARRLLQM
RKETLPQRLNVLEPPAEYLEEELITKDGQNVPPDAFYMLQSIRVFGHFAKPVFLRLCRHT
EILNVHAGSHLFKVGDPDENVFIVQSGLISVNITSIDGSIMPLKLVKTGDCVTSLLSFTD
VLTGHKKNYKTVSAQALEDSTIVRLPVAAFQEIFDDDPESLVQIIQVVMVRLQRVTFTAL
HQYLGLSTELVQNGLEERKMSPFISATKNESSMFLQQEISITDKKFESLLNQPKTDPKID
QKDWYLKIARKIFVKKLQLDNEDLLLGKVEIRKIPTNTYVMQEDSHKDAALVLLLNGSMI
VSQKMDPEGLTEAHMYSVNPGDIVGGLAVLTGEPGFLTFRANRPSIISILSRNTVYEIIR
VKPQIVLPIANTVVTRLSSFVRQVDFALDWLFFESGRAVYRQGEESDSTFIVLSGRLRSV
ITHENGKKELVAEYGKGDLVGIVEVITQTPRGTTVMAVRDSELAKLPEGLFNAIKKRFPG
VVSTLINLLGHRILGTWQKPTISKTLDTRPTQSNFSTIAIVPISDDVPLTSFTYELYHSL
CSIRSTIRLTSEFVRSVLGKSIMDLNNEYRLTTWLAQQEDQHKIALYQCDYSFSSWTQRC
IRQADCILLVTLGNKQPILGKYEKEIERLALRTHKELILIHREDSDLPSNTVEWLNIRSW
VSSHHHVQCPKRIFSKRSVSVICDQYEKILQTEVNIHSDYSRLARWLTGTSVGLVLGGGG
ARGAAHIGMIKAIQEAGIPIDMVGGVSIGAFMGAVWCGERDIIGMTRKASSWAESMTNRW
RQALDLTWPSTSMLTGQYFNHTLISALGETQIEDLWLPYFTITTDISASKMRIHTHGSLW
RYVRSSMSLSGYMPPLCDPIDGHLLLDGGYINNLPADIMRNLGAKHVLAIDVGSQDDMDF
TNYGDSLSGFWLMWKRFNPFTASVKVPNLEDIQSRLAYVSCVRQLEVVKTSDYCQYIRPP
IDKYKTLQFKSFEEIKEVGYQHGKTYFAGLKLAGKIPFGKQESMMSHIKPE
NT seq 3396 nt NT seq  +upstreamnt  +downstreamnt
atgggtttatttgacttcactaattccttccgagctataatctatagtccaacttttcaa
caatggataacgtccacttcctctttcatgctgctaagagaaaatatgttgataatagtt
gtatgcatactagcatcaatgttattaagatttgccttctacaaatggaaatcaaaattt
catgtgattcgaggaagtgacatctgttctgttcctaaaacaaggtttcgaaaacgtgat
agagttttattctatggcagaaaaatgttgagaaaggttaaaagtatatctggacaagta
cacggccaggggaaaaaaagaaaattagtaatcaaatttgctaggcgtttattacaaatg
aggaaagaaacattacctcagagattaaacgtattggaaccacctgctgagtatttagag
gaggaattaataactaaagacgggcaaaatgttcctcctgatgctttttatatgctacaa
agtattcgagtttttggccactttgccaaacccgtatttttaagactttgtcgtcataca
gaaatcttaaatgtacatgctggatcacatttgtttaaagttggtgatcctgatgaaaat
gtattcattgttcaaagtgggcttattagtgtgaatatcacttcaattgatggcagtatt
atgcctctgaaattagtaaaaacgggagattgtgttacatcattattaagttttactgat
gttctcactggccataaaaagaattataaaactgttagtgctcaagcacttgaagatagt
acaatagtacgattaccagttgctgcatttcaagaaatcttcgatgatgatccagaatca
ttagtccaaataatccaagtggtaatggtccgtttacagagagttacatttacagctctt
catcagtatttgggactatctactgagttggtacaaaatggtttagaagaaagaaaaatg
agtcctttcatttcagcaactaaaaatgagtcttccatgtttttacaacaagaaatttct
ataacagataaaaaatttgaatcacttttaaatcagcccaaaactgatccaaaaattgac
caaaaagattggtatctcaaaattgctaggaaaatttttgtcaaaaaacttcaacttgat
aatgaagatttattattgggaaaagtggaaattcgcaaaatacctactaatacatatgta
atgcaagaagattctcataaggatgctgcattagttttgttgttaaatggatcaatgata
gtatcacaaaaaatggacccagaaggattaactgaagctcatatgtattcagttaatcct
ggtgatattgttggtggattagctgtgttaactggggaacctggatttctgacgtttaga
gccaaccgtcccagtataatttctatattatcaagaaatactgtttatgagattataaga
gtaaaaccacaaattgttttacctatagcaaatacagtggttactcggttatcatcattt
gtacgtcaagtcgattttgcattggattggttgttttttgaaagtggacgtgcagtttat
agacaaggtgaagaatcggacagtacatttatcgttttgagtgggcggttgcgttctgtt
atcacacatgaaaatggtaaaaaagagttggttgctgaatatggaaaaggagatctagta
ggcattgtagaagttataacccaaacacctagaggaacaactgttatggcagttagagat
tcagaactagccaaattaccagaaggattatttaatgcaattaaaaaacgttttcctgga
gttgtttccacacttattaatcttttgggacatagaattttaggcacttggcagaagcct
acgattagtaaaacactagatacaagaccaacacaaagtaatttttcaactattgctatt
gtgcctatatcagatgatgtaccactaacgagttttacatatgaactttaccattcgtta
tgctctattagatcaactatacggttaacttccgaatttgtaagaagtgtattaggaaaa
tcaattatggatttgaataacgagtatcgtttgacaacatggttagcccagcaagaagac
caacataaaattgcactttatcaatgtgattattcgttctcttcttggactcagcgttgt
attcgacaagccgattgtatattgcttgtcacactaggaaataaacaacctatattagga
aaatatgaaaaagagattgaacgcctagcattacgtacccataaagaattaattttgata
cacagagaagattcagatttaccatctaatacagttgaatggttgaatataagatcatgg
gtatcttcacaccaccatgtacagtgtcctaaacgtatattttctaaacgttctgtttca
gtaatatgtgatcaatatgaaaaaatattacaaacagaagtcaacatacattcagattat
tctcgtttagctagatggttaacagggacttctgtgggtctagtgttaggtggcggagga
gcaagaggtgctgctcatattggaatgataaaagctatacaagaagctggtattcccata
gatatggttggtggtgtgagtattggtgcttttatgggagctgtatggtgtggcgaaaga
gatattattggaatgacacgcaaagccagctcttgggctgagtcaatgacaaatcggtgg
aggcaagcattagatttgacttggccatctacgtctatgttaactggtcaatattttaat
catacattgatttctgctcttggagaaacacaaattgaagacttgtggttgccatatttt
acaattactactgatatatcagccagtaaaatgcgaattcatactcatggatctttgtgg
cgttatgttcgatcatcaatgtctctatccggttacatgccacctttatgcgatccaatt
gatgggcatttattattagatggtggatacataaataatttaccagccgacattatgcgt
aaccttggagcaaaacatgttctcgctattgatgttggatctcaagatgatatggatttt
accaattatggagatagtttgtctgggttttggttgatgtggaaaagatttaatcctttt
actgcatcagttaaagttccaaatctggaagatatacaatctcgacttgcgtatgtttct
tgtgttcgtcaacttgaggtggtaaaaacgagtgattattgtcaatatataagacctcct
attgacaaatataagacacttcagtttaaaagttttgaagaaataaaggaagtaggctat
caacacggtaagacatattttgcgggattaaagttggctggaaaaattccgtttggaaaa
caagaatccatgatgtctcatattaaacctgaataa

DBGET integrated database retrieval system