KEGG   Acyrthosiphon pisum (pea aphid): 100168844Help
Entry
100168844         CDS       T01076                                 

Definition
alpha-N-acetylgalactosaminidase-like
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100168844
  Lipid metabolism
   00561 Glycerolipid metabolism
    100168844
   00600 Sphingolipid metabolism
    100168844
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    100168844
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100168844
Enzymes [BR:api01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     100168844
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 433 aa AA seqDB search
MIVTTMVRWTCCLIIMVVRGIDGLDNGLALTPPMGWLAWQRYRCITDCEMYPDDCVNEQL
FMKAADLLVSEGYSELGYNYVIVDDCWLAKNRSADGKLQADKIRFPSGIKALSDYVHSKG
LKFGIYEDWGTKTCAGYPGVLGHEELDAKTFAEWEVDYVKLDGCYSNVRHMDKGYPEFGR
HLNSTGRPMVYSCSWPAYQEEKGMLIDYASMAKHCNLWRNYDDIDDSWESMIKIADYFAQ
KQEFWAKYAGPGHWNDPDMLLIGNFGLTYDQSKTQMAIWAILAAPLLMSNKLAEVQPHFK
DILQNKKVIEVNQDKLGIQGTRVFRDKGIDIWTRPVEPFNDGYYSYAVAFVSRRVDGAPY
PYNITLEDLGLKNPNGYSIINLYGKEKSTTSCIFNSKTPIKVRVIPSGVVFLRMNIENSN
TPCTDHSKNQFFV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcaccacaatggtacgatggacttgctgtttgatcatcatggtagtacgaggg
attgacgggctcgataacgggctcgctcttacgccaccgatgggatggcttgcgtggcag
cgatacaggtgcatcacggattgcgaaatgtaccccgacgattgtgtcaacgaacaattg
ttcatgaaagcagcagatttattagttagcgaaggctactctgaattgggttataattat
gtcatcgttgatgactgttggttggccaagaacagatcagcagatggaaaattacaagcc
gacaaaataagatttccaagcggtattaaagcgttatcagactacgtacattctaaaggc
cttaagtttggaatatatgaagactggggtacaaaaacatgtgcaggctatcctggagta
ttggggcatgaagagctggatgctaaaacatttgcggaatgggaagttgactatgtcaaa
ctagacggatgttattcaaatgttagacacatggacaaaggctatcctgaattcgggagg
catttaaatagcactggaagaccaatggtgtattcttgtagctggccagcttatcaagaa
gaaaagggaatgttaattgactatgcatcaatggctaaacactgcaatctttggcgtaac
tacgatgatattgatgactcatgggaaagtatgatcaaaatagcggattattttgcacaa
aaacaagaattttgggcaaaatacgctggacctggacactggaatgatccagacatgctt
ttgattggtaactttggattaacgtacgatcaaagtaaaacacaaatggccatctgggca
atactggctgctccattgctgatgtcaaacaaattagcagaagtacaaccacactttaaa
gacattttacaaaacaaaaaagttattgaagtcaatcaagacaaacttggtattcaaggc
actagagtgtttagggacaagggtattgatatttggaccagaccagttgaacctttcaac
gatggatactattcgtatgcagtagcatttgtaagccgccgtgttgatggagctccttat
ccatacaatataacattagaagacttaggtctaaaaaatcctaatggctattcaattatt
aacctttatggaaaagaaaaaagtacaacctcttgtatttttaattcaaaaactccaatt
aaagttcgagttattccttcaggagtggttttcttgcgaatgaacatagaaaattcaaac
acaccatgtacagatcacagcaaaaatcagttctttgtgtaa

DBGET integrated database retrieval system