KEGG   Acyrthosiphon pisum (pea aphid): 100168844Help
Entry
100168844         CDS       T01076                                 

Definition
alpha-N-acetylgalactosaminidase-like
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:api00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:api00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:api00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:api00603]
Cellular Processes; Transport and catabolism; Lysosome [PATH:api04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 433 aa AA seqDB search
MIVTTMVRWTCCLIIMVVRGIDGLDNGLALTPPMGWLAWQRYRCITDCEMYPDDCVNEQL
FMKAADLLVSEGYSELGYNYVIVDDCWLAKNRSADGKLQADKIRFPSGIKALSDYVHSKG
LKFGIYEDWGTKTCAGYPGVLGHEELDAKTFAEWEVDYVKLDGCYSNVRHMDKGYPEFGR
HLNSTGRPMVYSCSWPAYQEEKGMLIDYASMAKHCNLWRNYDDIDDSWESMIKIADYFAQ
KQEFWAKYAGPGHWNDPDMLLIGNFGLTYDQSKTQMAIWAILAAPLLMSNKLAEVQPHFK
DILQNKKVIEVNQDKLGIQGTRVFRDKGIDIWTRPVEPFNDGYYSYAVAFVSRRVDGAPY
PYNITLEDLGLKNPNGYSIINLYGKEKSTTSCIFNSKTPIKVRVIPSGVVFLRMNIENSN
TPCTDHSKNQFFV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcaccacaatggtacgatggacttgctgtttgatcatcatggtagtacgaggg
attgacgggctcgataacgggctcgctcttacgccaccgatgggatggcttgcgtggcag
cgatacaggtgcatcacggattgcgaaatgtaccccgacgattgtgtcaacgaacaattg
ttcatgaaagcagcagatttattagttagcgaaggctactctgaattgggttataattat
gtcatcgttgatgactgttggttggccaagaacagatcagcagatggaaaattacaagcc
gacaaaataagatttccaagcggtattaaagcgttatcagactacgtacattctaaaggc
cttaagtttggaatatatgaagactggggtacaaaaacatgtgcaggctatcctggagta
ttggggcatgaagagctggatgctaaaacatttgcggaatgggaagttgactatgtcaaa
ctagacggatgttattcaaatgttagacacatggacaaaggctatcctgaattcgggagg
catttaaatagcactggaagaccaatggtgtattcttgtagctggccagcttatcaagaa
gaaaagggaatgttaattgactatgcatcaatggctaaacactgcaatctttggcgtaac
tacgatgatattgatgactcatgggaaagtatgatcaaaatagcggattattttgcacaa
aaacaagaattttgggcaaaatacgctggacctggacactggaatgatccagacatgctt
ttgattggtaactttggattaacgtacgatcaaagtaaaacacaaatggccatctgggca
atactggctgctccattgctgatgtcaaacaaattagcagaagtacaaccacactttaaa
gacattttacaaaacaaaaaagttattgaagtcaatcaagacaaacttggtattcaaggc
actagagtgtttagggacaagggtattgatatttggaccagaccagttgaacctttcaac
gatggatactattcgtatgcagtagcatttgtaagccgccgtgttgatggagctccttat
ccatacaatataacattagaagacttaggtctaaaaaatcctaatggctattcaattatt
aacctttatggaaaagaaaaaagtacaacctcttgtatttttaattcaaaaactccaatt
aaagttcgagttattccttcaggagtggttttcttgcgaatgaacatagaaaattcaaac
acaccatgtacagatcacagcaaaaatcagttctttgtgtaa

DBGET integrated database retrieval system