KEGG   Acyrthosiphon pisum (pea aphid): 100168865Help
Entry
100168865         CDS       T01076                                 

Definition
acetylcholinesterase-like
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:api00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 663 aa AA seqDB search
MSVDCVYTSAVTLLLCCSAVLGRPSSNGGADGGGGGGGGGGAGAGGGGGGGGGGGGGSVD
DTDESPVVVTSSGMVQGYTKIIANREVRVYTGIPFAKPPVGPLRFRRPVPVDPWTGVLNA
TRLPNTCYQERYEYFPGFIGEEMWNPNTKLSEDCLYLNIWIPKKQRTRHHSNNAHHAKIP
VLVWIYGGGYMSGTSTLDIYDGDLLAATFDVMIASMQYRLGAFGSLYLTPELPEDSDDAP
GNMGLWDQALAIKWIKENAAAFGADPETITLFGESAGGGSVSVHLISPETRGMVRRGIIQ
SGTVNAPWSYMTGERAVDIAKKLLDDCNCNSTSLNNNPIGTMSCMRSVDASTISKKQWNS
YSGILGFPSAPTVDGILLPEHPLDMLAKANFSDIDILIGSNLNEGTYFLLYDFVDFFDRT
SATALPKEKFVQIVNVIFKDRTQLERDAIIYQYSGWEKKEVDDKYSNQKQLSDVVADYFF
VCPTNLFANIVSSRGARVYYYFFTHRTDSHLWGDWMGVLHGDEMQYVFGHPLNMSLPYNA
RERDLSIRIMEAFTRFSLTGTPVSDDIDWPLYNESNPIYHVWNAAELHVGYGPRAAECQF
WNGFFPKIAQALKETTKITCEDYPDSMPTTNENCTFTSSFATINPRISFTIIFIFVLPAH
GLF
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgactgcgtttacaccagtgcagtgacgttactgctgtgttgttcggccgtc
ctgggccggccgtcgtccaatggtggagcggacggtggtggcggaggcggcggcggtgga
ggcgccggagccggtggtggtggtggaggtggtggcggtggtggcggtgggtctgtggat
gacaccgacgagagcccggtggtggtgaccagctctggcatggtgcagggctacacgaag
attattgcgaaccgcgaggtgcgggtgtacacgggcattccgttcgccaagccaccggtg
ggccccctaaggttccggcgccctgtgcctgttgacccgtggacgggagtgctgaacgcc
accaggctgccgaacacgtgctaccaggagcggtacgagtatttccctgggttcattggc
gaggagatgtggaacccgaacactaagctctccgaggactgcctgtacctgaacatctgg
ataccgaagaaacaacgcaccaggcaccattcgaacaacgcgcatcacgccaagataccg
gtactggtatggatatacggcggaggttacatgtccggtacttcgacattagacatctac
gacggcgatctgctggcggccactttcgacgtgatgatcgcctccatgcagtacaggctc
ggggcattcggttcgttgtatttaacgccagagctgccagaggatagcgacgacgcgcct
ggcaatatgggattatgggatcaggcgctggctatcaagtggatcaaagaaaatgcagcg
gctttcggcgctgatccagagacaattacgttgtttggcgaatcggctggtggtggatca
gtgagcgtgcacctaatatcgccggagacaagaggcatggtgagacgtgggatcatacaa
tctggcaccgtgaatgcaccttggagctatatgactggcgaacgggcagtggacatagca
aagaagttgttggacgattgcaattgcaattcgacgtcgttgaataacaacccgatcggc
accatgtcgtgcatgcgatctgtcgacgcaagtactatatccaaaaagcagtggaacagc
tattccggtattttgggtttcccatctgcgcccaccgtggacgggattctcctgccagaa
cacccgctagacatgttggctaaggcgaacttttcggacatcgacatactcattggaagc
aatctgaacgaaggaacatattttttgctgtatgactttgtcgatttcttcgaccggacg
tcggccaccgcattgcccaaggagaaatttgtgcaaatagtcaacgtaatattcaaagac
agaacacagctggaaagagacgccattatatatcagtattcgggatgggaaaaaaaagaa
gtggacgacaaatattccaatcaaaaacaactgagcgacgtggttgcagattatttcttt
gtttgtccgaccaacctctttgccaacatcgtgtcaagtcgtggagctcgagtgtactac
tatttcttcactcacaggacagactcacacttgtggggtgattggatgggtgtgttgcac
ggcgacgagatgcaatacgtgtttggccatccgttgaacatgtcgttgccgtacaacgcc
agggagagagacttgagcatacgaatcatggaagcattcaccagattttcgttgaccgga
acacctgtatcagatgacatagattggccactatacaatgaatcaaacccaatatatcat
gtttggaatgctgctgaattacacgtaggatacggacctagagcagctgaatgccagttt
tggaacggatttttcccgaaaatcgctcaagccttgaaagaaactaccaaaattacttgt
gaagattatccagactcgatgcccactaccaacgaaaattgtacgttcacgtcatcgttt
gctactatcaatccacgaatctccttcaccataatattcatcttcgttctaccggcacat
ggattgttctaa

DBGET integrated database retrieval system