KEGG   Acyrthosiphon pisum (pea aphid): 100168972Help
Entry
100168972         CDS       T01076                                 

Definition
(RefSeq) nuclear pore complex protein Nup205
  KO
K14310  
nuclear pore complex protein Nup205
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:api00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100168972
Messenger RNA biogenesis [BR:api03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100168972
Chromosome [BR:api03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100168972
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
APHIDBASE: 
Position
Un
AA seq 959 aa AA seqDB search
METESLQSSWSPYTELLPVLENIFTNERPNVAFLKRILRAAKPHFLNVFKNPPKNVKSRE
QIMKVLADGKPIQKFEMLALPKDMAEEVLILSDMYDLDELMSLELLNTARYQNPKYPELC
RGLVAVLLYYNAHRMLASSLRLLIEGSTGRTWMPRVDPACAQHLGQFVDQLMNDGLFINI
LIVLENKDLTKEIELLQKNKAIGGPKHHQLVVSLFTEIRTMLAECVFYYSIQFGLSKQQL
ISLLKHLQKIKPDVESHGVVSKVPLFMVTSFLYAIDLDCMNNTQEISGDTKEQFLTSAYT
ELISHDWEWPELKSIATFGLAVAFSKLRSSQHVFQDKNLFKIDETLISNAMDTKVFRFLN
QNVAPSEFLHYVEFMIKKFHQLITEFIVMMPHTVKEIRNKSDEIAHTILIYYQEGLEPPT
SEENHFEQLLMLMAALYAKDPLELNLNLDYWPPSREQLKTIKMSSFLTTQKFQASLYRFI
CQTGDMLPHMLFVPYLNMLSSLATSETGAENVFNHFHSNATNSNLTWDHFFKTFLRYYTN
LRQENIPPTDTVYKRGHQKGITALEIQGLQAVLKLIRSVAEQSVKSKVTFVDRSEWETLP
VLLGLVSCPVRISLKADLILTLSTLVKPPPSIIAINFWQTLEASQIIVTVPTISSYQSRG
IMAELDDLEPRNEEYPLTIALLKLLSTLTEQPVPNLLGSNNRTPGFDPYLNFVLNNIFLK
CLSRGYKKQNEKWEVSGICLELVLKFLNQYEPQQTDFVGSSVFLPDNTTINVNPPPGFHI
MTYLCTNSDFLRTILNIMHTGCQMFDLYTSFSGKEAMEKTTLVVLRLLEQALHLQQIFLN
ASISSGSPLIYTGLHKTLVSINVATNEPDYIIDLSKFVTYTHLPEHAYHAIRILMTITSY
PIPQSHMVSYFTSNPKLTIGIRHGFVECLEEEESTKKERMYMSLGSSMNQTEDNQRKKR
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atggagactgaatcgttacaaagttcttggtcaccatatacggagctgctgcctgttttg
gagaacatttttacaaatgaaagaccgaatgtagcatttttaaaacgcattttacgtgct
gccaaaccacattttttgaatgtatttaagaacccaccaaaaaatgttaaaagtcgagaa
caaataatgaaagttttggcagatggaaaaccaattcagaaatttgagatgttggcatta
ccaaaagatatggccgaagaagtgcttattctctcagatatgtatgatttagatgaactt
atgtctttggaacttttaaatactgctcgataccaaaatccaaaatatccagaactttgc
cgaggtttagtagcagtattgttgtattataatgcacatcgtatgcttgcatcttcttta
agacttctcattgaaggaagcacaggtcgtacttggatgccacgtgtagatccagcatgt
gcacaacatcttggccaatttgttgatcaactaatgaatgatggattatttattaatatt
ttaattgtattggaaaacaaagatttgactaaagaaattgaattgcttcaaaaaaataaa
gcaattggtggtccaaaacatcaccaacttgttgtgagcttatttactgaaattcgtaca
atgttagcagaatgtgtattttattattctattcaatttggattatcaaaacaacaatta
attagtttattgaaacatttgcaaaagataaaaccagatgtagaatcgcatggagtggtt
agcaaagtacctttatttatggtgacttcatttttatatgctattgatttggattgtatg
aataatactcaagaaattagtggtgatactaaggagcaatttttaacttcggcatacact
gaacttatttcacacgattgggaatggccagaactgaaaagtattgctacttttggatta
gctgtagcattctcaaaattacgttcttcacaacatgtatttcaggataaaaatttattc
aaaattgatgaaacattaattagcaatgctatggatactaaagtatttagatttttgaac
caaaatgttgctccttcagaatttcttcattatgtggaattcatgataaaaaaatttcat
caattgatcactgaatttattgttatgatgccacataccgtcaaagaaataagaaacaaa
tcagatgaaatagcacatacaattttaatttattaccaagaaggattagaacctccaaca
agtgaagaaaatcattttgaacaattgttaatgttgatggcagcattgtatgcaaaagat
ccattagaattgaacttaaatttggattattggccaccatctcgtgaacaattaaaaacg
atcaagatgtcatcatttttaacgactcaaaaatttcaagcttcattatacagatttatc
tgtcaaactggtgacatgttgcctcacatgttatttgtaccatatttaaatatgttaagc
tcattagcaacatctgaaactggggctgaaaatgtgtttaatcactttcattctaatgca
actaattccaatcttacttgggatcactttttcaaaacttttttgagatattatacaaat
ttaagacaagaaaatattcctccgaccgacactgtgtacaaaagaggacatcaaaaaggt
attactgctcttgaaatacaaggtctccaagctgtattaaaattaatcaggagtgtagca
gaacaaagcgttaagtcaaaagtaacttttgtggaccgttccgaatgggagacacttcca
gttttgttgggtcttgtatcatgcccagtgagaatttctctcaaggcagatttaattttg
acactttctacattagttaaacctccaccatcaataatagcaatcaatttttggcaaaca
ctcgaagcatctcaaataattgtaactgtaccaactataagcagctatcaaagtcgtggt
ataatggcagagttagatgatctagaacctcgcaatgaagaatacccattgacaattgct
ttattgaaattattgtctactcttacagaacagccagtaccaaaccttttgggttcaaat
aaccgaacacctggtttcgatccatatttaaattttgttttaaataatatttttctgaaa
tgtctctctagaggttataaaaaacaaaatgaaaaatgggaagtaagtggcatatgcctg
gaactcgtattaaagtttttgaaccaatatgaacctcagcaaacggattttgtgggtagt
agtgtttttctacccgataatactactattaatgtcaacccaccccctggttttcatatc
atgacatacttatgcacaaattctgattttttaagaactattttaaatataatgcacacg
ggctgtcaaatgtttgatctctatacctcatttagtggtaaagaagcaatggaaaaaaca
acattagttgtactacgccttttagaacaggctttacatttacaacaaatatttttaaat
gcatctatttcttctgggtcacctcttatatatactggattgcataaaactcttgttagt
attaatgtagcaacaaatgaaccagattatataatcgatttatccaagtttgtaacttat
acacatttaccagagcatgcatatcatgcaattcgaatactgatgacaataacttcttat
ccgatacctcagtctcatatggtatcatattttacttccaatcctaaacttacaattggt
attagacatggatttgtagaatgtctagaagaagaagaatcaacaaagaaagaacgtatg
tatatgtcactaggaagtagtatgaatcaaaccgaagataatcaaaggaaaaagaggtga

DBGET integrated database retrieval system