KEGG   Acyrthosiphon pisum (pea aphid): 100168972Help
Entry
100168972         CDS       T01076                                 

Definition
nuclear pore complex protein Nup205-like
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:api00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100168972
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 959 aa AA seqDB search
METESLQSSWSPYTELLPVLENIFTNERPNVAFLKRILRAAKPHFLNVFKNPPKNVKSRE
QIMKVLADGKPIQKFEMLALPKDMAEEVLILSDMYDLDELMSLELLNTARYQNPKYPELC
RGLVAVLLYYNAHRMLASSLRLLIEGSTGRTWMPRVDPACAQHLGQFVDQLMNDGLFINI
LIVLENKDLTKEIELLQKNKAIGGPKHHQLVVSLFTEIRTMLAECVFYYSIQFGLSKQQL
ISLLKHLQKIKPDVESHGVVSKVPLFMVTSFLYAIDLDCMNNTQEISGDTKEQFLTSAYT
ELISHDWEWPELKSIATFGLAVAFSKLRSSQHVFQDKNLFKIDETLISNAMDTKVFRFLN
QNVAPSEFLHYVEFMIKKFHQLITEFIVMMPHTVKEIRNKSDEIAHTILIYYQEGLEPPT
SEENHFEQLLMLMAALYAKDPLELNLNLDYWPPSREQLKTIKMSSFLTTQKFQASLYRFI
CQTGDMLPHMLFVPYLNMLSSLATSETGAENVFNHFHSNATNSNLTWDHFFKTFLRYYTN
LRQENIPPTDTVYKRGHQKGITALEIQGLQAVLKLIRSVAEQSVKSKVTFVDRSEWETLP
VLLGLVSCPVRISLKADLILTLSTLVKPPPSIIAINFWQTLEASQIIVTVPTISSYQSRG
IMAELDDLEPRNEEYPLTIALLKLLSTLTEQPVPNLLGSNNRTPGFDPYLNFVLNNIFLK
CLSRGYKKQNEKWEVSGICLELVLKFLNQYEPQQTDFVGSSVFLPDNTTINVNPPPGFHI
MTYLCTNSDFLRTILNIMHTGCQMFDLYTSFSGKEAMEKTTLVVLRLLEQALHLQQIFLN
ASISSGSPLIYTGLHKTLVSINVATNEPDYIIDLSKFVTYTHLPEHAYHAIRILMTITSY
PIPQSHMVSYFTSNPKLTIGIRHGFVECLEEEESTKKERMYMSLGSSMNQTEDNQRKKR
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atggagactgaatcgttacaaagttcttggtcaccatatacggagctgctgcctgttttg
gagaacatttttacaaatgaaagaccgaatgtagcatttttaaaacgcattttacgtgct
gccaaaccacattttttgaatgtatttaagaacccaccaaaaaatgttaaaagtcgagaa
caaataatgaaagttttggcagatggaaaaccaattcagaaatttgagatgttggcatta
ccaaaagatatggccgaagaagtgcttattctctcagatatgtatgatttagatgaactt
atgtctttggaacttttaaatactgctcgataccaaaatccaaaatatccagaactttgc
cgaggtttagtagcagtattgttgtattataatgcacatcgtatgcttgcatcttcttta
agacttctcattgaaggaagcacaggtcgtacttggatgccacgtgtagatccagcatgt
gcacaacatcttggccaatttgttgatcaactaatgaatgatggattatttattaatatt
ttaattgtattggaaaacaaagatttgactaaagaaattgaattgcttcaaaaaaataaa
gcaattggtggtccaaaacatcaccaacttgttgtgagcttatttactgaaattcgtaca
atgttagcagaatgtgtattttattattctattcaatttggattatcaaaacaacaatta
attagtttattgaaacatttgcaaaagataaaaccagatgtagaatcgcatggagtggtt
agcaaagtacctttatttatggtgacttcatttttatatgctattgatttggattgtatg
aataatactcaagaaattagtggtgatactaaggagcaatttttaacttcggcatacact
gaacttatttcacacgattgggaatggccagaactgaaaagtattgctacttttggatta
gctgtagcattctcaaaattacgttcttcacaacatgtatttcaggataaaaatttattc
aaaattgatgaaacattaattagcaatgctatggatactaaagtatttagatttttgaac
caaaatgttgctccttcagaatttcttcattatgtggaattcatgataaaaaaatttcat
caattgatcactgaatttattgttatgatgccacataccgtcaaagaaataagaaacaaa
tcagatgaaatagcacatacaattttaatttattaccaagaaggattagaacctccaaca
agtgaagaaaatcattttgaacaattgttaatgttgatggcagcattgtatgcaaaagat
ccattagaattgaacttaaatttggattattggccaccatctcgtgaacaattaaaaacg
atcaagatgtcatcatttttaacgactcaaaaatttcaagcttcattatacagatttatc
tgtcaaactggtgacatgttgcctcacatgttatttgtaccatatttaaatatgttaagc
tcattagcaacatctgaaactggggctgaaaatgtgtttaatcactttcattctaatgca
actaattccaatcttacttgggatcactttttcaaaacttttttgagatattatacaaat
ttaagacaagaaaatattcctccgaccgacactgtgtacaaaagaggacatcaaaaaggt
attactgctcttgaaatacaaggtctccaagctgtattaaaattaatcaggagtgtagca
gaacaaagcgttaagtcaaaagtaacttttgtggaccgttccgaatgggagacacttcca
gttttgttgggtcttgtatcatgcccagtgagaatttctctcaaggcagatttaattttg
acactttctacattagttaaacctccaccatcaataatagcaatcaatttttggcaaaca
ctcgaagcatctcaaataattgtaactgtaccaactataagcagctatcaaagtcgtggt
ataatggcagagttagatgatctagaacctcgcaatgaagaatacccattgacaattgct
ttattgaaattattgtctactcttacagaacagccagtaccaaaccttttgggttcaaat
aaccgaacacctggtttcgatccatatttaaattttgttttaaataatatttttctgaaa
tgtctctctagaggttataaaaaacaaaatgaaaaatgggaagtaagtggcatatgcctg
gaactcgtattaaagtttttgaaccaatatgaacctcagcaaacggattttgtgggtagt
agtgtttttctacccgataatactactattaatgtcaacccaccccctggttttcatatc
atgacatacttatgcacaaattctgattttttaagaactattttaaatataatgcacacg
ggctgtcaaatgtttgatctctatacctcatttagtggtaaagaagcaatggaaaaaaca
acattagttgtactacgccttttagaacaggctttacatttacaacaaatatttttaaat
gcatctatttcttctgggtcacctcttatatatactggattgcataaaactcttgttagt
attaatgtagcaacaaatgaaccagattatataatcgatttatccaagtttgtaacttat
acacatttaccagagcatgcatatcatgcaattcgaatactgatgacaataacttcttat
ccgatacctcagtctcatatggtatcatattttacttccaatcctaaacttacaattggt
attagacatggatttgtagaatgtctagaagaagaagaatcaacaaagaaagaacgtatg
tatatgtcactaggaagtagtatgaatcaaaccgaagataatcaaaggaaaaagaggtga

DBGET integrated database retrieval system