KEGG   Acyrthosiphon pisum (pea aphid): 100169081Help
Entry
100169081         CDS       T01076                                 

Definition
beta-galactosidase-like
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:api00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:api00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:api00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:api00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:api00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:api04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 635 aa AA seqDB search
MNWISVCLLCSLINPAFLDTQKPTFTIDYENNEFLKDGKVFRYVSGSLHYFRIPQLYWKD
RIQKMKAAGLNTITTYVEWSLHEPFPGVYDFEGIADLEYFIELIKNENMYLILRPGPYIC
AERDFGGFPYWLLNVTPKRSLRTNNSSYKKYVSKWFSVLMPIIQPHLYGNGGNIILVQVE
NEYGSYYACDSEYKLWIRDLFRSYVENKAVLFTIDGCGQSYFDCGVIPEVYATVDFGISS
NASQCFDFMRKVQKGGPLVNSEFYPGWLTHWQESESIVNTTDVVKQMKVMLAMNASFSFY
MFHGGTNFGFTSGANTNDTKESIGYLPQLTSYDYNAPLDEAGDPTEKYFKIKQTLEEAKY
AVTNEISPNPAPKGAYGKFYLRPLVSIFEKVAQRIKPVISNVPLPFEDLDINTGFVMYET
TLTDDQKNVENPVNLTVNTVRDRAIIYLDQVQVGTMNRLKANTTISLNINRTVQNLSILI
ENQGRINFGDFIEDRKGIFDQVILGNKILSPWKMTAYPLNDTSWISSIKSVENVNSVKLP
AFFKTQFTLPVNYTKCLDTYLDTSGWTKGVVFLNNVNLGRYWPLGGPQVTLYVPAPFLKP
SPYVNTLVILELEGTSQDLSVKFVDKPILNGPIMT
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgaattggatatctgtctgcttattgtgctcactaatcaatcctgcttttttggatact
caaaaaccaacttttaccattgactatgaaaataatgaatttctcaaagacggcaaagta
ttccgatatgtttctggttcattgcactatttccgaatccctcaactttattggaaagat
agaattcaaaaaatgaaagctgctggattgaacaccataacaacttatgtagaatggagt
ttacatgaaccatttcctggagtgtatgattttgaagggattgctgatttggagtatttt
attgaattaatcaaaaatgaaaacatgtatctaattttgcgaccaggaccatatatatgc
gctgaacgagattttggtggatttccatattggttattaaacgtgacgcctaaaaggagc
ttgcggactaacaactcaagttataaaaaatatgtttcgaaatggtttagtgtgcttatg
ccaataattcaacctcatttatatggaaatggaggaaatataattttggtccaggtagaa
aatgagtatggaagttattatgcctgtgattctgagtataaattatggatacgtgattta
tttaggagttatgtagaaaataaggctgtgctttttacgattgatggatgtggtcagtca
tactttgactgtggagttattccagaagtatatgcaactgtagatttcggaatttcatca
aatgcttcccaatgttttgacttcatgagaaaggttcaaaaaggaggtccactagtaaac
tctgagttctatcccggctggttaactcattggcaagaatcagaatctatagtaaacacc
accgatgttgtaaaacaaatgaaagtaatgttggcaatgaatgcttcgtttagcttttat
atgtttcacggaggtacaaattttggatttacatcgggagcgaatacaaatgacaccaaa
gaaagtattggatacttaccgcagttgacctcatacgattataatgctccattggatgaa
gctggagaccctactgaaaagtatttcaaaattaaacagacacttgaagaagctaaatat
gctgtgacaaacgagatatcaccaaatcccgcacctaaaggtgcctatggaaaattctat
ttaagacctttggttagcatatttgaaaaggttgctcaacgtattaaaccagtgatcagt
aatgttcctttaccatttgaggacttagatattaacactggttttgttatgtatgaaaca
acattaacagatgatcaaaagaatgttgaaaatccagtaaacctaactgtgaacactgtt
agagatcgagcaatcatttacctggatcaagtacaagtgggtactatgaatcgattaaaa
gctaatactacaataagcttaaacattaaccgtactgttcaaaacctaagcattttaatt
gagaatcagggaaggattaattttggagactttattgaagataggaagggaatttttgat
caagtgattctcggaaacaaaatattgagcccttggaaaatgactgcatatcctctgaat
gatacatcatggatttcttcaatcaaatcagttgaaaatgtcaatagtgttaaattacca
gcattttttaagacacagtttacattaccagtaaactatacaaaatgtttagacacttat
ttggacacttcaggatggacaaagggtgtagtgtttttaaacaatgtaaaccttggtcgg
tattggccacttggtggacctcaagttacactttatgtgccagctccttttttaaaacca
tcaccttatgtcaatacactagtgatattggaacttgaaggtacatctcaagatttgtct
gtgaaatttgtggataaacctattcttaatggtcctataatgacatag

DBGET integrated database retrieval system