KEGG   Acyrthosiphon pisum (pea aphid): 100169107Help
Entry
100169107         CDS       T01076                                 

Definition
(RefSeq) protein disulfide-isomerase
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:api00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100169107
Enzymes [BR:api01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100169107
Chaperones and folding catalysts [BR:api03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100169107
Membrane trafficking [BR:api04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100169107
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100169107
  Exosomal proteins of colorectal cancer cells
   100169107
  Exosomal proteins of bladder cancer cells
   100169107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 OST3_OST6 Thioredoxin_2 Thioredoxin_7 Thioredoxin_8 Calsequestrin AhpC-TSA ERp29_N Redoxin Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 100169107
NCBI-ProteinID: XP_008183165
APHIDBASE: ACYPI009755
UniProt: J9K9Y0
Position
Un
AA seq 508 aa AA seqDB search
MILHVAFAAFLLVNSAIADAGVQEQVAVESDEGVLVLTKDNFQSIVSSSEYLLVKFYAPW
CGHCKQLAPEYANAAQHLAQNELSVKLGKVDATIESDLAEQFGIRGYPTLKFFKNGKPID
YSGGRTKDEIIQWVLKKSGPAAKVLQSEEEVQSFIEGKHVAIVGYFENLESDAAKLFSEL
ADSVDDHPFGLVSDYSKFSNLEHKDTFVLYKDFDEKKVPYDKDIANVEDIKTFIFVHSLP
PIIEFNQDTAQKIFGGQIKSHLLLFLSKKEGHFEKFIDDIKPVALDFRGKIVFVTINADE
EEHQRILEFFGMKKNEVPSMRAIKLEDDMTKFKPESPDLTGENVRKFVSDFVEGKVKQHL
LSEELPEDWNKTPVWTLTATNFDSVALDSTKNVLVEFYAPWCGHCKQLAPIFDKVGEHFA
DKDDIVIAKMDATVNELEHTKISSFPTLTYYPKGDSPKAIEYNGDRTLEAIIKFIEADGK
QESSSSTTSEEGDEEEEEVEREKPKDEL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgattcttcacgtagcgttcgcagcgttcctgttggttaactcggcgatcgccgacgcc
ggtgtccaggaacaggtggccgtcgagtcagacgagggcgtgcttgtgttgaccaaagac
aacttccaaagtatcgtctcgtcgtccgaatacttgctcgtcaaattctatgcaccatgg
tgtggtcactgtaaacaattagcaccagaatatgcaaatgcagctcaacacttagcccag
aatgaattatcagttaaattgggcaaagtggatgccactattgagagtgacttagctgaa
cagtttggaatccgtgggtatccaactttaaagttctttaaaaatggaaaaccaattgac
tattcaggtggccgaactaaagatgaaatcattcaatgggtattgaagaaatctggacca
gctgcaaaagtattgcaatcagaagaagaagtacagtcgttcattgagggaaaacatgtt
gctattgtaggttatttcgaaaatttagaatcagatgctgcaaaattattttcagaattg
gcggattcggttgatgatcatccatttggtcttgtatcagattattctaaattctctaat
ttagagcacaaagatacatttgttttatataaagattttgatgaaaagaaagttccatat
gataaagatattgccaatgttgaagacatcaagacatttatttttgttcattcgttgcct
cccattatagagttcaaccaagatactgctcaaaaaatatttggtggtcagattaagagt
catttgttgctcttcttatctaaaaaagaaggacattttgaaaaattcattgatgacatt
aagcctgttgcacttgacttcagaggaaaaattgtgtttgttactattaatgctgatgaa
gaagaacatcaaaggattttggagttctttggaatgaaaaagaatgaagtaccaagcatg
agggcaatcaaacttgaagacgatatgaccaaatttaaaccagaatctcctgatttaacc
ggagaaaatgtgaggaaatttgtttccgattttgtcgaaggaaaagttaagcaacatttg
ctctctgaagaattacccgaagattggaacaaaactccagtctggactttgactgctact
aactttgatagtgtagctttagattcaactaagaatgtacttgtagaattttatgctcca
tggtgcggacactgtaaacagcttgcaccaattttcgataaagttggagaacacttcgct
gataaagatgatattgtcattgcaaaaatggatgctacagttaatgaacttgagcacact
aaaatttccagcttccctacactaacatactatccaaagggagatagtccaaaagccatt
gaatataatggagacagaacattagaagcaatcattaagtttatcgaagctgatggaaaa
caagaaagttcttctagcacaacgagtgaggaaggagatgaagaagaagaagaagtagaa
cgtgagaagcctaaagatgaattgtag

DBGET integrated database retrieval system