KEGG   Acyrthosiphon pisum (pea aphid): 100169107Help
Entry
100169107         CDS       T01076                                 

Definition
protein disulfide-isomerase
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:api00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100169107
Enzymes [BR:api01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100169107
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100169107
  Exosomal proteins of colorectal cancer cells
   100169107
  Exosomal proteins of bladder cancer cells
   100169107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 508 aa AA seqDB search
MILHVAFAAFLLVNSAIADAGVQEQVAVESDEGVLVLTKDNFQSIVSSSEYLLVKFYAPW
CGHCKQLAPEYANAAQHLAQNELSVKLGKVDATIESDLAEQFGIRGYPTLKFFKNGKPID
YSGGRTKDEIIQWVLKKSGPAAKVLQSEEEVQSFIEGKHVAIVGYFENLESDAAKLFSEL
ADSVDDHPFGLVSDYSKFSNLEHKDTFVLYKDFDEKKVPYDKDIANVEDIKTFIFVHSLP
PIIEFNQDTAQKIFGGQIKSHLLLFLSKKEGHFEKFIDDIKPVALDFRGKIVFVTINADE
EEHQRILEFFGMKKNEVPSMRAIKLEDDMTKFKPESPDLTGENVRKFVSDFVEGKVKQHL
LSEELPEDWNKTPVWTLTATNFDSVALDSTKNVLVEFYAPWCGHCKQLAPIFDKVGEHFA
DKDDIVIAKMDATVNELEHTKISSFPTLTYYPKGDSPKAIEYNGDRTLEAIIKFIEADGK
QESSSSTTSEEGDEEEEEVEREKPKDEL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgattcttcacgtagcgttcgcagcgttcctgttggttaactcggcgatcgccgacgcc
ggtgtccaggaacaggtggccgtcgagtcagacgagggcgtgcttgtgttgaccaaagac
aacttccaaagtatcgtctcgtcgtccgaatacttgctcgtcaaattctatgcaccatgg
tgtggtcactgtaaacaattagcaccagaatatgcaaatgcagctcaacacttagcccag
aatgaattatcagttaaattgggcaaagtggatgccactattgagagtgacttagctgaa
cagtttggaatccgtgggtatccaactttaaagttctttaaaaatggaaaaccaattgac
tattcaggtggccgaactaaagatgaaatcattcaatgggtattgaagaaatctggacca
gctgcaaaagtattgcaatcagaagaagaagtacagtcgttcattgagggaaaacatgtt
gctattgtaggttatttcgaaaatttagaatcagatgctgcaaaattattttcagaattg
gcggattcggttgatgatcatccatttggtcttgtatcagattattctaaattctctaat
ttagagcacaaagatacatttgttttatataaagattttgatgaaaagaaagttccatat
gataaagatattgccaatgttgaagacatcaagacatttatttttgttcattcgttgcct
cccattatagagttcaaccaagatactgctcaaaaaatatttggtggtcagattaagagt
catttgttgctcttcttatctaaaaaagaaggacattttgaaaaattcattgatgacatt
aagcctgttgcacttgacttcagaggaaaaattgtgtttgttactattaatgctgatgaa
gaagaacatcaaaggattttggagttctttggaatgaaaaagaatgaagtaccaagcatg
agggcaatcaaacttgaagacgatatgaccaaatttaaaccagaatctcctgatttaacc
ggagaaaatgtgaggaaatttgtttccgattttgtcgaaggaaaagttaagcaacatttg
ctctctgaagaattacccgaagattggaacaaaactccagtctggactttgactgctact
aactttgatagtgtagctttagattcaactaagaatgtacttgtagaattttatgctcca
tggtgcggacactgtaaacagcttgcaccaattttcgataaagttggagaacacttcgct
gataaagatgatattgtcattgcaaaaatggatgctacagttaatgaacttgagcacact
aaaatttccagcttccctacactaacatactatccaaagggagatagtccaaaagccatt
gaatataatggagacagaacattagaagcaatcattaagtttatcgaagctgatggaaaa
caagaaagttcttctagcacaacgagtgaggaaggagatgaagaagaagaagaagtagaa
cgtgagaagcctaaagatgaattgtag

DBGET integrated database retrieval system