KEGG   Acyrthosiphon pisum (pea aphid): 100169125Help
Entry
100169125         CDS       T01076                                 

Definition
membrane-bound alkaline phosphatase-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:api00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 557 aa AA seqDB search
MRPYGVPCAFALSIATALLLGATTDGFEIRHTDNNAEHIAARRRASNENISPDENNKQFW
YDAGNNLLRKKLNSERQYGVAKNVIFFIGDGMSIATLASARIYMGQKQNNTGSEKEMLSF
EKFPFTGLSKTYCVDSQVADSACSATAYLTGVKGNIETIGVSGAVSNRDCLASNEPANQA
VSSMRWAQRAGKRTGVVSNMRVTHATPAGAYANVAQRNWECDDDVFIDELADKSCTTQPD
IARQLIERETGQNLNVVMGGGRAKFFPNTEKDQQNFNGQRRDGRDLIKEWLNINRTSGAS
SAYVTDRSQLKSVNTSETDYLLGLFASSHMSYNLLANKSQEPTLVEMTEAAIEVLSKGDA
GYYLFVEGGLIDWAHHSNMAQLALDEAVMLSKAVGRAAELTSREDTLIVVTSDHSHTMTI
NGYPHRGSDILGHPMIALPDQMPYSTLSYANGPSYKARYNLSNDKTDDPQYEFPSMVNLT
WETHGGDDVAVFASGPWAHLFVGNYEQNYIPHAISYAAQMGPGAELERKHVADSSSVKIL
VSSSLAVFTALVALLLR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccatacggagttccatgcgcctttgcgctgtcgatcgcgacggcgttgcttttg
ggagctaccactgacggtttcgaaataaggcacaccgacaacaatgctgaacatatcgct
gccagaagacgggcgagcaacgaaaacataagtcccgacgaaaacaacaagcagttttgg
tacgatgccggaaacaatcttctgcggaagaaattgaattcagaaaggcagtacggcgtg
gccaagaacgtgatttttttcatcggcgatggcatgtcaatagccactttggcctcagcc
agaatttacatggggcagaagcaaaataatacagggagtgaaaaggaaatgttgtcattt
gagaagttcccgtttactggtctgtcgaaaacctactgcgtagatagccaggtggccgac
tcggcttgctcggccacggcgtatctgacgggcgtaaagggcaacatcgagaccataggc
gtgtccggtgccgtgtccaacagggactgcttggccagcaacgaacctgcgaaccaagcg
gtgtccagcatgcggtgggctcaacgggccggcaagaggacgggcgtggtgtccaacatg
agggtgactcacgccacgccggccggcgcttacgccaatgtggcgcaacgtaactgggaa
tgcgacgatgacgtgtttattgacgaattagccgacaaatcgtgcacgacacaaccggac
atcgcccgtcagctgatcgagagagaaacgggccaaaacctgaacgttgtaatgggaggt
ggaagggcaaaattttttcccaatactgaaaaagatcaacaaaactttaatggacaaaga
cgtgacggcagagatttgattaaggaatggttaaatataaatcgtacttctggggcaagt
agtgcttatgttaccgaccgatcccaattgaagtctgtgaataccagcgaaacggattat
cttctcggtctgtttgcatccagtcacatgtcctacaacttattagccaataagtcccag
gaacccacgttggtagaaatgacggaggcagccatcgaggtgctgtccaaaggtgacgcc
ggttactatctgttcgtcgagggcggacttatcgactgggcgcaccacagtaacatggcg
cagctggctctcgatgaggctgtaatgttgtcgaaggcagtgggacgggctgccgagttg
acgtcccgggaagacactctgatcgtagttacgtccgaccactcgcataccatgaccata
aacggttacccgcaccgcggtagcgacattctgggacacccaatgatcgcccttcccgat
caaatgccatactcgacgctcagctacgccaacggtccgtcttacaaagcacggtacaat
ttgagcaacgacaaaacggatgatccccaatacgagttcccgtcgatggtaaacttaacg
tgggagacgcacggcggtgacgacgtggcggtattcgcttcaggcccatgggcccacctg
ttcgttggcaactacgaacagaactacataccacacgcgataagctacgcagcccaaatg
gggcctggggctgaactcgaacggaaacacgtggctgattcgtctagcgtgaagattttg
gtcagttcgtcgctggctgtattcacggcactcgtcgcgcttctactccggtaa

DBGET integrated database retrieval system