KEGG   Acyrthosiphon pisum (pea aphid): 100169157Help
Entry
100169157         CDS       T01076                                 

Definition
dual specificity protein kinase TTK-like
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 603 aa AA seqDB search
MGSKFYNNNIEENDGDTDNYITCPLLQIKYSRPRKPITSRLGQKARSLKYNNDNRALFEN
KTADADLGSSFQVHTPKKLVHSLEKLDLVQNTPFVRPAIKAQSHSNIETPSDTFTNLNRN
TVRKLNFKPALPLSTKRSLYYNKENLPEQSKEELNNLESIILPQSDISTTSCSIDVEENV
KEIASKLPVINDDTCYTSPETSKSNYDTSLYHSLRETTSIPKSSFLSFCKNSSNSLVDSS
LSTEQLECQPLDAHPKHHNTSIPELTPIAKCNNFVVRAQTSTYINSTVSVQDEELKQPIN
LSGSVCIKCATDNFISVKGIKYSILNTLGHGGSSIVYEVLHPETNQVMAIKKVDLSEVEN
IIAKGYLNEVSLLQNLQDCESVIRLFDSQYTVKEKILYMVMEKGDTDLSKLIRSTKNMSV
HMIMYYWTEMLTTVSEIHAKGVIHSDLKPANFLLVSGRLKLIDFGIASKIQGDMTSVLKD
VTTGTWNYMSPECIRSGGSNFEGHKINQKSDVWSLGCILYSLVYGKTPYSHLTNTWQKLQ
SIAESKQNINFPSHSKVFTEGVPSVLQQTMQLCLIKDVKARPYVIDLLKLIEDTVFKPMT
AQN
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgggatcaaaattctacaacaataatatcgaagaaaacgatggagataccgataattat
attacatgtcctttattacaaataaaatattctagaccaagaaaacctatcacaagtcgt
ttgggacaaaaagccagatctttaaaatataataatgataaccgagcattatttgaaaat
aaaacagcagacgcagatttgggaagttcatttcaagtacacacacctaagaaattagtt
catagtttagaaaaacttgatttagtacaaaacactccatttgttcgtccagcaattaaa
gctcaaagtcatagtaatatagaaactccaagtgatacatttaccaacttgaacaggaat
actgttcgtaaattaaatttcaaacccgctcttccattaagtaccaagaggtcattatat
tataacaaagaaaatttaccagaacagtcaaaagaagaactgaataatctagaatctata
atattgcctcaaagtgatattagtacaacttcttgttcaattgatgtagaagaaaatgtt
aaggaaattgcaagcaaattaccagttataaatgatgatacatgttatacttcacctgaa
acatcaaagtcaaattatgatactagtttgtatcatagtctcagagaaacaacttctata
ccaaaatcatcatttttgtctttttgtaaaaacagttctaattctttagttgattcttcc
ttgtcaacagaacagttagaatgtcaacctttagatgctcatcctaaacaccataacacc
agtataccagaactaactcctatagctaaatgtaataattttgttgtccgtgctcaaact
tctacatatatcaattctactgtatctgttcaagatgaagagcttaaacagccaattaat
ttatcaggtagtgtgtgtattaaatgtgccactgataactttatatctgttaaaggaatc
aagtatagtatacttaatacactgggacatggcggatctagtattgtatatgaggtccta
cacccagaaactaatcaagtaatggcaataaaaaaggtagacttatctgaagttgaaaat
attatagctaaaggatacttaaacgaagtcagtttgttacaaaatttgcaagactgtgaa
agtgttatacgtttatttgacagtcagtatactgtcaaagaaaagattctttacatggta
atggaaaaaggtgatacagatctttcaaaactcatccgtagtacaaaaaatatgtcagtt
cacatgattatgtactattggacagaaatgttgaccactgttagtgagatacacgctaaa
ggtgttattcattcagatctcaaacctgcaaattttcttctagttagtggtcgtttaaaa
ttaatagactttggtattgcatcaaaaatacaaggcgacatgacaagtgtattgaaggat
gtgactactggaacttggaactatatgagtccagaatgtataagaagtggaggctctaat
tttgaaggacataaaataaaccaaaaatcagatgtatggtcattaggatgtatattatat
agtctggtttatggtaagactccatattcacatttgacaaacacctggcaaaagttgcag
tccattgctgaatctaagcaaaatattaattttcccagtcatagtaaagtatttactgaa
ggtgtaccatcggtacttcagcaaacaatgcagttatgtttgataaaagatgtgaaagcc
agaccttatgtcattgatttgttgaagcttattgaagatacagtatttaaacctatgaca
gcacaaaattaa

DBGET integrated database retrieval system