KEGG   Acyrthosiphon pisum (pea aphid): 100169157Help
Entry
100169157         CDS       T01076                                 

Definition
(RefSeq) dual specificity protein kinase TTK-like
  KO
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100169157
Protein kinases [BR:api01001]
 Serine/threonine protein kinases: Other group
  TTK family
   100169157
Chromosome [BR:api03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100169157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 608 aa AA seqDB search
MMNFNMGSKFYNNNIEENDGDTDNYITCPLLQIKYSRPRKPITSRLGQKARSLKYNNDNR
ALFENKTADADLGSSFQVHTPKKLVHSLEKLDLVQNTPFVRPAIKAQSHSNIETPSDTFT
NLNRNTVRKLNFKPALPLSTKRSLYYNKENLPEQSKEELNNLESIILPQSDISTTSCSID
VEENVKEIASKLPVINDDTCYTSPETSKSNYDTSLYHSLRETTSIPKSSFLSFCKNSSNS
LVDSSLSTEQLECQPLDAHPKHHNTSIPELTPIAKCNNFVVRAQTSTYINSTVSVQDEEL
KQPINLSGSVCIKCATDNFISVKGIKYSILNTLGHGGSSIVYEVLHPETNQVMAIKKVDL
SEVENIIAKGYLNEVSLLQNLQDCESVIRLFDSQYTVKEKILYMVMEKGDTDLSKLIRST
KNMSVHMIMYYWTEMLTTVSEIHAKGVIHSDLKPANFLLVSGRLKLIDFGIASKIQGDMT
SVLKDVTTGTWNYMSPECIRSGGSNFEGHKINQKSDVWSLGCILYSLVYGKTPYSHLTNT
WQKLQSIAESKQNINFPSHSKVFTEGVPSVLQQTMQLCLIKDVKARPYVIDLLKLIEDTV
FKPMTAQN
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacttcaatatgggatcaaaattctacaacaataatatcgaagaaaacgatgga
gataccgataattatattacatgtcctttattacaaataaaatattctagaccaagaaaa
cctatcacaagtcgtttgggacaaaaagccagatctttaaaatataataatgataaccga
gcattatttgaaaataaaacagcagacgcagatttgggaagttcatttcaagtacacaca
cctaagaaattagttcatagtttagaaaaacttgatttagtacaaaacactccatttgtt
cgtccagcaattaaagctcaaagtcatagtaatatagaaactccaagtgatacatttacc
aacttgaacaggaatactgttcgtaaattaaatttcaaacccgctcttccattaagtacc
aagaggtcattatattataacaaagaaaatttaccagaacagtcaaaagaagaactgaat
aatctagaatctataatattgcctcaaagtgatattagtacaacttcttgttcaattgat
gtagaagaaaatgttaaggaaattgcaagcaaattaccagttataaatgatgatacatgt
tatacttcacctgaaacatcaaagtcaaattatgatactagtttgtatcatagtctcaga
gaaacaacttctataccaaaatcatcatttttgtctttttgtaaaaacagttctaattct
ttagttgattcttccttgtcaacagaacagttagaatgtcaacctttagatgctcatcct
aaacaccataacaccagtataccagaactaactcctatagctaaatgtaataattttgtt
gtccgtgctcaaacttctacatatatcaattctactgtatctgttcaagatgaagagctt
aaacagccaattaatttatcaggtagtgtgtgtattaaatgtgccactgataactttata
tctgttaaaggaatcaagtatagtatacttaatacactgggacatggcggatctagtatt
gtatatgaggtcctacacccagaaactaatcaagtaatggcaataaaaaaggtagactta
tctgaagttgaaaatattatagctaaaggatacttaaacgaagtcagtttgttacaaaat
ttgcaagactgtgaaagtgttatacgtttatttgacagtcagtatactgtcaaagaaaag
attctttacatggtaatggaaaaaggtgatacagatctttcaaaactcatccgtagtaca
aaaaatatgtcagttcacatgattatgtactattggacagaaatgttgaccactgttagt
gagatacacgctaaaggtgttattcattcagatctcaaacctgcaaattttcttctagtt
agtggtcgtttaaaattaatagactttggtattgcatcaaaaatacaaggcgacatgaca
agtgtattgaaggatgtgactactggaacttggaactatatgagtccagaatgtataaga
agtggaggctctaattttgaaggacataaaataaaccaaaaatcagatgtatggtcatta
ggatgtatattatatagtctggtttatggtaagactccatattcacatttgacaaacacc
tggcaaaagttgcagtccattgctgaatctaagcaaaatattaattttcccagtcatagt
aaagtatttactgaaggtgtaccatcggtacttcagcaaacaatgcagttatgtttgata
aaagatgtgaaagccagaccttatgtcattgatttgttgaagcttattgaagatacagta
tttaaacctatgacagcacaaaattaa

DBGET integrated database retrieval system